Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04684
Gene name
Locationscaffold_05:198904..201305
Strand-
Gene length (bp)2401
Transcript length (bp)2049
Coding sequence length (bp)2049
Protein length (aa) 683

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 4.2E-54 84 245
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 1.2E-46 490 637
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 2.8E-41 282 427

GO

GO Term Description Terminal node
GO:0030976 thiamine pyrophosphate binding Yes
GO:0003824 catalytic activity Yes
GO:0000287 magnesium ion binding Yes
GO:0043169 cation binding No
GO:0050997 quaternary ammonium group binding No
GO:0019842 vitamin binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:1901681 sulfur compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1595 0.1 0.0439 0.135 0.9559 0.2092 0.0378 0.0675 0.1186 0.0438

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 244.14 117.15 371.13
Alive In ants, during behavior modification 246.78 111.85 381.71
Dead In ants, recently dead 250.44 115.70 385.18

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.972158 no
Alive Dead 0.955545 no
Dead Fungus 0.934898 no

Orthologs

Orthofinder run ID4
Orthogroup1958
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1806
Ophiocordyceps australis map64 (Brazil) OphauB2|3423
Ophiocordyceps camponoti-floridani Ophcf2|04684 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6431
Ophiocordyceps kimflemingae Ophio5|5188
Ophiocordyceps subramaniannii Hirsu2|2118

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04684
MMLRGRLVVGRARLSGRWLAASSGRGRASAANGKGVRRNQTAAAPQARPIPSPAFNGQDQDRSHVSPLVNPRKKD
MDESFIGKTGGEIFHEMMLRHGVKHIFGYAGGAILPVFDAIYNSKNFDFIMPRHEQGAGHMAEGYARASGRPGVV
LVTSGPGATNVVTPMQDALSDGTPLVVFCGQVPTTAIGSDAFQEADVVGISRACTKWNVMVKNIAELPRRINEAF
EIATSGRPGPVLVDLPKDVTAGVLRRAIPTDAALPSLPSAASRAAADLSRRQLDASVARAAALINGARRPVIYAG
QGVILSPGGPELLRELADKASVPVTTTLQGLGAFDELDDKALHMLGMHGSAYANMAMQSADVIVALGARFDDRVT
GNIAKFAPEAKAAAAEGRGGIVHLEVMPKNINKVVQATEAVEGDVAANLRRLLPLVEARSMADRADWFGQIADWK
RRWPLSHYEREGAMVKPQTVIEELSRLTADRKHETLISTGVGQHQMWTAQHFRWRHPRTMITSGGLGTMGFGLPA
AIGAKVARPDALVVDIDGDASFNMTMTELATASQFGIGVKVVVLNNEEQGMVTQWQNLFYEDRYAHTHQINPDYL
KLAESMRVPARRVEKPDEVKSGLRWLIDSEGPALLEVVTDKKVPVLPMVPAGSALHEFLVYDEATDKKRRELMRQ
RTCGLHG*
Coding >Ophcf2|04684
ATGATGCTTCGCGGTCGTTTGGTGGTGGGGAGAGCCCGGCTTTCGGGCAGGTGGCTCGCTGCCTCTTCGGGGAGG
GGACGGGCTTCAGCAGCAAATGGGAAGGGGGTGAGAAGGAACCAGACCGCCGCTGCGCCACAGGCTCGTCCCATC
CCCAGCCCAGCCTTTAACGGCCAAGATCAGGACCGCAGTCACGTCTCGCCGTTGGTGAATCCTCGCAAAAAGGAC
ATGGACGAGTCCTTCATCGGCAAGACGGGTGGCGAAATATTTCACGAGATGATGCTGCGTCACGGGGTCAAGCAC
ATCTTCGGCTACGCTGGTGGCGCCATCTTGCCCGTCTTCGACGCCATCTACAACTCCAAAAACTTCGACTTCATC
ATGCCCCGCCACGAGCAGGGTGCCGGTCACATGGCCGAGGGTTACGCGCGGGCCTCTGGCCGGCCCGGCGTCGTA
CTCGTTACTTCGGGCCCCGGGGCCACCAATGTGGTGACACCAATGCAGGACGCCCTCTCGGACGGCACGCCGCTC
GTCGTCTTCTGCGGTCAGGTGCCGACGACGGCCATTGGCAGCGATGCCTTTCAGGAGGCTGACGTCGTGGGCATC
TCGCGCGCCTGCACCAAGTGGAACGTCATGGTCAAGAACATTGCCGAGCTGCCGCGCCGCATAAACGAGGCCTTT
GAGATTGCCACCTCGGGCCGGCCTGGTCCTGTCCTCGTCGACCTGCCCAAGGACGTGACGGCCGGCGTGCTTCGC
CGTGCCATTCCGACCGACGCGGCGCTGCCGTCGCTGCCGAGTGCCGCTTCCCGAGCGGCGGCCGACCTGAGCCGG
CGCCAGCTCGATGCCTCGGTCGCCCGCGCCGCCGCCCTCATCAACGGCGCCCGCCGGCCCGTCATCTACGCCGGA
CAGGGCGTCATCCTCTCACCCGGCGGGCCCGAGCTGCTGAGGGAGCTGGCTGACAAGGCGTCGGTGCCCGTGACG
ACGACGCTGCAGGGGCTCGGCGCCTTCGACGAGCTCGACGACAAAGCGCTCCACATGCTCGGCATGCACGGCTCT
GCCTATGCTAATATGGCCATGCAGTCGGCCGACGTCATCGTCGCCCTCGGTGCCCGCTTCGACGACCGCGTGACG
GGCAACATTGCAAAGTTCGCACCCGAGGCCAAGGCGGCCGCCGCCGAGGGCCGTGGTGGCATCGTCCACCTCGAG
GTGATGCCCAAGAATATCAACAAGGTGGTGCAGGCGACCGAGGCGGTCGAGGGCGACGTGGCGGCCAATCTGCGG
CGGCTGTTGCCTTTGGTGGAGGCGCGTTCCATGGCTGACCGCGCCGACTGGTTCGGGCAGATCGCCGACTGGAAG
CGGCGCTGGCCTCTTTCTCACTACGAGCGGGAGGGCGCGATGGTCAAGCCGCAGACGGTCATCGAGGAGCTGAGC
CGGCTGACGGCGGACCGCAAGCACGAAACGCTCATATCGACGGGCGTGGGCCAGCATCAGATGTGGACGGCGCAG
CACTTCCGCTGGCGCCACCCGCGCACCATGATCACCTCGGGCGGGCTGGGCACCATGGGCTTCGGCCTGCCGGCG
GCCATCGGGGCCAAGGTGGCGCGGCCCGATGCGCTTGTGGTGGATATTGACGGCGATGCCTCGTTCAACATGACC
ATGACGGAGCTCGCGACGGCGTCCCAGTTCGGAATCGGCGTCAAAGTGGTGGTTCTCAACAACGAAGAACAGGGC
ATGGTGACGCAGTGGCAGAACCTCTTCTACGAGGACCGGTACGCGCACACGCACCAGATCAACCCGGACTACCTC
AAGCTGGCCGAGTCGATGCGGGTGCCGGCTCGAAGGGTGGAGAAGCCAGATGAGGTCAAGTCCGGGCTGCGGTGG
CTGATTGATAGCGAGGGACCGGCGCTTCTCGAGGTGGTGACGGATAAGAAGGTGCCGGTGCTGCCGATGGTGCCG
GCCGGGTCGGCGCTGCACGAGTTTCTCGTCTATGACGAGGCGACGGATAAGAAGCGACGCGAGTTGATGAGGCAA
AGAACGTGCGGCTTGCACGGTTGA
Transcript >Ophcf2|04684
ATGATGCTTCGCGGTCGTTTGGTGGTGGGGAGAGCCCGGCTTTCGGGCAGGTGGCTCGCTGCCTCTTCGGGGAGG
GGACGGGCTTCAGCAGCAAATGGGAAGGGGGTGAGAAGGAACCAGACCGCCGCTGCGCCACAGGCTCGTCCCATC
CCCAGCCCAGCCTTTAACGGCCAAGATCAGGACCGCAGTCACGTCTCGCCGTTGGTGAATCCTCGCAAAAAGGAC
ATGGACGAGTCCTTCATCGGCAAGACGGGTGGCGAAATATTTCACGAGATGATGCTGCGTCACGGGGTCAAGCAC
ATCTTCGGCTACGCTGGTGGCGCCATCTTGCCCGTCTTCGACGCCATCTACAACTCCAAAAACTTCGACTTCATC
ATGCCCCGCCACGAGCAGGGTGCCGGTCACATGGCCGAGGGTTACGCGCGGGCCTCTGGCCGGCCCGGCGTCGTA
CTCGTTACTTCGGGCCCCGGGGCCACCAATGTGGTGACACCAATGCAGGACGCCCTCTCGGACGGCACGCCGCTC
GTCGTCTTCTGCGGTCAGGTGCCGACGACGGCCATTGGCAGCGATGCCTTTCAGGAGGCTGACGTCGTGGGCATC
TCGCGCGCCTGCACCAAGTGGAACGTCATGGTCAAGAACATTGCCGAGCTGCCGCGCCGCATAAACGAGGCCTTT
GAGATTGCCACCTCGGGCCGGCCTGGTCCTGTCCTCGTCGACCTGCCCAAGGACGTGACGGCCGGCGTGCTTCGC
CGTGCCATTCCGACCGACGCGGCGCTGCCGTCGCTGCCGAGTGCCGCTTCCCGAGCGGCGGCCGACCTGAGCCGG
CGCCAGCTCGATGCCTCGGTCGCCCGCGCCGCCGCCCTCATCAACGGCGCCCGCCGGCCCGTCATCTACGCCGGA
CAGGGCGTCATCCTCTCACCCGGCGGGCCCGAGCTGCTGAGGGAGCTGGCTGACAAGGCGTCGGTGCCCGTGACG
ACGACGCTGCAGGGGCTCGGCGCCTTCGACGAGCTCGACGACAAAGCGCTCCACATGCTCGGCATGCACGGCTCT
GCCTATGCTAATATGGCCATGCAGTCGGCCGACGTCATCGTCGCCCTCGGTGCCCGCTTCGACGACCGCGTGACG
GGCAACATTGCAAAGTTCGCACCCGAGGCCAAGGCGGCCGCCGCCGAGGGCCGTGGTGGCATCGTCCACCTCGAG
GTGATGCCCAAGAATATCAACAAGGTGGTGCAGGCGACCGAGGCGGTCGAGGGCGACGTGGCGGCCAATCTGCGG
CGGCTGTTGCCTTTGGTGGAGGCGCGTTCCATGGCTGACCGCGCCGACTGGTTCGGGCAGATCGCCGACTGGAAG
CGGCGCTGGCCTCTTTCTCACTACGAGCGGGAGGGCGCGATGGTCAAGCCGCAGACGGTCATCGAGGAGCTGAGC
CGGCTGACGGCGGACCGCAAGCACGAAACGCTCATATCGACGGGCGTGGGCCAGCATCAGATGTGGACGGCGCAG
CACTTCCGCTGGCGCCACCCGCGCACCATGATCACCTCGGGCGGGCTGGGCACCATGGGCTTCGGCCTGCCGGCG
GCCATCGGGGCCAAGGTGGCGCGGCCCGATGCGCTTGTGGTGGATATTGACGGCGATGCCTCGTTCAACATGACC
ATGACGGAGCTCGCGACGGCGTCCCAGTTCGGAATCGGCGTCAAAGTGGTGGTTCTCAACAACGAAGAACAGGGC
ATGGTGACGCAGTGGCAGAACCTCTTCTACGAGGACCGGTACGCGCACACGCACCAGATCAACCCGGACTACCTC
AAGCTGGCCGAGTCGATGCGGGTGCCGGCTCGAAGGGTGGAGAAGCCAGATGAGGTCAAGTCCGGGCTGCGGTGG
CTGATTGATAGCGAGGGACCGGCGCTTCTCGAGGTGGTGACGGATAAGAAGGTGCCGGTGCTGCCGATGGTGCCG
GCCGGGTCGGCGCTGCACGAGTTTCTCGTCTATGACGAGGCGACGGATAAGAAGCGACGCGAGTTGATGAGGCAA
AGAACGTGCGGCTTGCACGGTTGA
Gene >Ophcf2|04684
ATGATGCTTCGCGGTCGTTTGGTGGTGGGGAGAGCCCGGCTTTCGGGCAGGTGGCTCGCTGCCTCTTCGGGGAGG
GGACGGGCTTCAGCAGCAAATGGGAAGGGGGTGAGAAGGAACCAGACCGCCGCTGCGCCGTGAGTTTTTTCTTCT
CTTTTCATCTAAAACCGGGCGAGGCCCTGGTTTTCTCGCGGTACGAGGGGCCATTGGACGATGTGGTCTCTTTTA
CTCGTGAATGCCATTCGACGGGCCTCGGAATGGATGGCGAACAAGAAATATGAAGAAACAGATGCTGACGATGCT
CGCATACAACAGACAGGCTCGTCCCATCCCCAGCCCAGCCTTTAACGGCCAAGATCAGGACCGCAGTCACGTCTC
GCCGTTGGTGAATCCTCGCAAAAAGGACATGGACGAGTCGTGAGTCTGGACACTGCACTGTTGGTTCGTCCCGTG
CTGATAAGGCGGATGGCAGCTTCATCGGCAAGACGGGTGGCGAAATATTTCACGAGATGATGCTGCGTCACGGGG
TCAAGCACATCTGTACGTGTCATCTCATATCTTCACTCCGTGGGCCCAACTGACGCAGCCCAGTCGGCTACGCTG
GTGGCGCCATCTTGCCCGTCTTCGACGCCATCTACAACTCCAAAAACTTCGACTTCATCATGCCCCGCCACGAGC
AGGGTGCCGGTCACATGGCCGAGGGTTACGCGCGGGCCTCTGGCCGGCCCGGCGTCGTACTCGTTACTTCGGGCC
CCGGGGCCACCAATGTGGTGACACCAATGCAGGACGCCCTCTCGGACGGCACGCCGCTCGTCGTCTTCTGCGGTC
AGGTGCCGACGACGGCCATTGGCAGCGATGCCTTTCAGGAGGCTGACGTCGTGGGCATCTCGCGCGCCTGCACCA
AGTGGAACGTCATGGTCAAGAACATTGCCGAGCTGCCGCGCCGCATAAACGAGGCCTTTGAGATTGCCACCTCGG
GCCGGCCTGGTCCTGTCCTCGTCGACCTGCCCAAGGACGTGACGGCCGGCGTGCTTCGCCGTGCCATTCCGACCG
ACGCGGCGCTGCCGTCGCTGCCGAGTGCCGCTTCCCGAGCGGCGGCCGACCTGAGCCGGCGCCAGCTCGATGCCT
CGGTCGCCCGCGCCGCCGCCCTCATCAACGGCGCCCGCCGGCCCGTCATCTACGCCGGACAGGGCGTCATCCTCT
CACCCGGCGGGCCCGAGCTGCTGAGGGAGCTGGCTGACAAGGCGTCGGTGCCCGTGACGACGACGCTGCAGGGGC
TCGGCGCCTTCGACGAGCTCGACGACAAAGCGCTCCACATGCTCGGCATGCACGGCTCTGCCTATGCTAATATGG
CCATGCAGTCGGCCGACGTCATCGTCGCCCTCGGTGCCCGCTTCGACGACCGCGTGACGGGCAACATTGCAAAGT
TCGCACCCGAGGCCAAGGCGGCCGCCGCCGAGGGCCGTGGTGGCATCGTCCACCTCGAGGTGATGCCCAAGAATA
TCAACAAGGTGGTGCAGGCGACCGAGGCGGTCGAGGGCGACGTGGCGGCCAATCTGCGGCGGCTGTTGCCTTTGG
TGGAGGCGCGTTCCATGGCTGACCGCGCCGACTGGTTCGGGCAGATCGCCGACTGGAAGCGGCGCTGGCCTCTTT
CTCACTACGAGCGGGAGGGCGCGATGGTCAAGCCGCAGACGGTCATCGAGGAGCTGAGCCGGCTGACGGCGGACC
GCAAGCACGAAACGCTCATATCGACGGGCGTGGGCCAGCATCAGATGTGGACGGCGCAGCACTTCCGCTGGCGCC
ACCCGCGCACCATGATCACCTCGGGCGGGCTGGGCACCATGGGCTTCGGCCTGCCGGCGGCCATCGGGGCCAAGG
TGGCGCGGCCCGATGCGCTTGTGGTGGATATTGACGGCGATGCCTCGTTCAACATGACCATGACGGAGCTCGCGA
CGGCGTCCCAGTTCGGAATCGGCGTCAAAGTGGTGGTTCTCAACAACGAAGAACAGGGCATGGTGACGCAGTGGC
AGAACCTCTTCTACGAGGACCGGTACGCGCACACGCACCAGATCAACCCGGACTACCTCAAGCTGGCCGAGTCGA
TGCGGGTGCCGGCTCGAAGGGTGGAGAAGCCAGATGAGGTCAAGTCCGGGCTGCGGTGGCTGATTGATAGCGAGG
GACCGGCGCTTCTCGAGGTGGTGACGGATAAGAAGGTGCCGGTGCTGCCGATGGTGCCGGCCGGGTCGGCGCTGC
ACGAGTTTCTCGTCTATGACGAGGGTGAGTGTTCCCGTCTCTTGAGTTAAGCGTTCATTATGTGTGCAATCTGCT
GACTTGCGGCTCTCCAGCGACGGATAAGAAGCGACGCGAGTTGATGAGGCAAAGAACGTGCGGCTTGCACGGTTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail