Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04682
Gene name
Locationscaffold_05:193577..195288
Strand+
Gene length (bp)1711
Transcript length (bp)1650
Coding sequence length (bp)1650
Protein length (aa) 550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.7E-34 73 476

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 138 160 22
3 167 184 17
4 194 216 22
5 223 244 21
6 254 276 22
7 288 310 22
8 330 352 22
9 365 387 22
10 392 414 22
11 421 443 22
12 458 480 22
13 501 523 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 192.38 99.19 285.57
Alive In ants, during behavior modification 181.42 91.07 271.78
Dead In ants, recently dead 58.19 32.17 84.21

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.821848 no
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04682
MKVTSLLQRLKAGEPVQKPESVRPPSTSHVIPSSSGDDSDGGALVTDVKFLGRARPLVFSGPLAEAGFIFTVVLS
MMTSEYFVGGFDLILPSIAEALHMPPAARTWPAGVVTLTTASLLQPFARLCDMYGSRRVFLYGQAWLLAWSVVTG
FSVNTTMLIVCRAMQGIGAAAFLPAGLALLGHTYRPGPRKNVAFSIYGAFACVGFYFGIFLGALAAEFMTWRWYF
WFGAVACLITLASGLLTIPRDLSDVNPDAAMDWLGVCTIVPGLVLVVFAFTDAGDAFGGWRNPYIFVTLIVGVLF
LAAAVYVQGWVSAQPLLPPALFKPKYMKRLMLSLFCYYGVFGIFLLYTSFYIENTLGVKPLMAAAWYTPLAVGGM
FLAIGGGLVLHIIPNRILLLISGFGFFLSVLLFALIPGPDDGKSLSFIYWAYVFSAMLGGTLGIDVTFNVTNVFI
TTAMPRRLQAAASGVINSLLYLGVAFWLGVAQTAISTADERQEGGIKPEAQYRIAFWTGVGLAAVGLLLTASIKM
GQASAGLTADERLAIEDEERSVSG*
Coding >Ophcf2|04682
ATGAAGGTTACCTCGCTCCTCCAGCGACTCAAGGCTGGTGAGCCCGTCCAGAAACCTGAAAGTGTGCGCCCTCCG
TCGACAAGCCATGTCATCCCGTCGTCATCGGGTGACGATAGCGACGGTGGCGCCCTCGTCACCGACGTCAAGTTT
CTCGGCCGGGCCCGTCCGCTCGTTTTCTCAGGCCCCCTCGCTGAGGCCGGCTTCATCTTCACTGTCGTTCTCTCC
ATGATGACGAGCGAGTACTTCGTCGGCGGCTTCGACCTCATTCTTCCCTCCATCGCCGAGGCGCTACACATGCCA
CCCGCAGCCCGCACTTGGCCCGCCGGCGTCGTGACGCTGACGACAGCCTCGCTGCTACAGCCCTTTGCCCGCCTC
TGCGACATGTACGGCAGCCGGCGTGTCTTTCTCTATGGCCAGGCCTGGCTGCTAGCCTGGTCCGTCGTCACCGGC
TTCAGCGTCAACACCACCATGCTCATCGTCTGCCGCGCCATGCAGGGCATCGGCGCTGCCGCCTTTCTACCGGCC
GGTCTCGCCCTACTAGGCCACACGTACCGGCCTGGTCCGCGCAAGAATGTGGCCTTTTCCATCTATGGCGCCTTC
GCCTGCGTCGGCTTCTACTTTGGCATCTTCCTCGGCGCCCTGGCGGCGGAGTTCATGACCTGGAGATGGTACTTT
TGGTTCGGCGCCGTCGCCTGCCTCATCACCCTGGCCTCTGGCCTACTTACGATCCCTCGCGACCTCTCGGACGTG
AATCCGGACGCGGCCATGGACTGGTTAGGCGTCTGCACCATCGTCCCGGGCCTCGTCCTCGTCGTCTTTGCCTTT
ACCGACGCCGGCGACGCCTTCGGAGGCTGGCGCAATCCATACATCTTCGTGACGCTCATCGTCGGCGTCTTATTC
CTCGCCGCAGCCGTCTACGTGCAGGGCTGGGTCTCGGCTCAGCCGTTGCTGCCGCCGGCTCTGTTCAAGCCCAAG
TACATGAAGCGGCTGATGCTGTCGCTGTTTTGCTACTACGGCGTGTTTGGAATCTTTCTTTTGTACACGAGCTTC
TACATCGAGAACACCCTCGGCGTCAAGCCTCTCATGGCAGCAGCCTGGTACACTCCTCTCGCCGTCGGCGGCATG
TTCCTCGCCATCGGCGGCGGCCTCGTCCTACACATCATCCCCAACCGCATTCTCCTCCTCATCTCCGGCTTCGGC
TTCTTCCTCTCCGTCCTCCTCTTCGCCCTCATCCCCGGCCCCGATGACGGGAAGTCCCTCAGCTTCATCTACTGG
GCCTACGTCTTCTCCGCTATGCTGGGCGGCACCCTCGGCATCGATGTCACCTTCAACGTCACAAACGTCTTCATC
ACTACCGCCATGCCCCGTCGGCTGCAGGCAGCCGCCAGCGGCGTCATCAACAGCCTGCTATATCTGGGCGTCGCC
TTCTGGCTCGGCGTCGCACAGACAGCCATCTCGACCGCCGATGAGAGACAAGAGGGGGGCATCAAGCCCGAGGCT
CAGTACCGCATTGCCTTTTGGACGGGCGTCGGGCTCGCGGCTGTTGGGCTGCTGCTGACGGCTAGCATAAAAATG
GGACAGGCGTCAGCTGGTCTGACGGCTGACGAGAGGCTAGCGATAGAGGACGAGGAGAGAAGCGTGAGTGGTTAA
Transcript >Ophcf2|04682
ATGAAGGTTACCTCGCTCCTCCAGCGACTCAAGGCTGGTGAGCCCGTCCAGAAACCTGAAAGTGTGCGCCCTCCG
TCGACAAGCCATGTCATCCCGTCGTCATCGGGTGACGATAGCGACGGTGGCGCCCTCGTCACCGACGTCAAGTTT
CTCGGCCGGGCCCGTCCGCTCGTTTTCTCAGGCCCCCTCGCTGAGGCCGGCTTCATCTTCACTGTCGTTCTCTCC
ATGATGACGAGCGAGTACTTCGTCGGCGGCTTCGACCTCATTCTTCCCTCCATCGCCGAGGCGCTACACATGCCA
CCCGCAGCCCGCACTTGGCCCGCCGGCGTCGTGACGCTGACGACAGCCTCGCTGCTACAGCCCTTTGCCCGCCTC
TGCGACATGTACGGCAGCCGGCGTGTCTTTCTCTATGGCCAGGCCTGGCTGCTAGCCTGGTCCGTCGTCACCGGC
TTCAGCGTCAACACCACCATGCTCATCGTCTGCCGCGCCATGCAGGGCATCGGCGCTGCCGCCTTTCTACCGGCC
GGTCTCGCCCTACTAGGCCACACGTACCGGCCTGGTCCGCGCAAGAATGTGGCCTTTTCCATCTATGGCGCCTTC
GCCTGCGTCGGCTTCTACTTTGGCATCTTCCTCGGCGCCCTGGCGGCGGAGTTCATGACCTGGAGATGGTACTTT
TGGTTCGGCGCCGTCGCCTGCCTCATCACCCTGGCCTCTGGCCTACTTACGATCCCTCGCGACCTCTCGGACGTG
AATCCGGACGCGGCCATGGACTGGTTAGGCGTCTGCACCATCGTCCCGGGCCTCGTCCTCGTCGTCTTTGCCTTT
ACCGACGCCGGCGACGCCTTCGGAGGCTGGCGCAATCCATACATCTTCGTGACGCTCATCGTCGGCGTCTTATTC
CTCGCCGCAGCCGTCTACGTGCAGGGCTGGGTCTCGGCTCAGCCGTTGCTGCCGCCGGCTCTGTTCAAGCCCAAG
TACATGAAGCGGCTGATGCTGTCGCTGTTTTGCTACTACGGCGTGTTTGGAATCTTTCTTTTGTACACGAGCTTC
TACATCGAGAACACCCTCGGCGTCAAGCCTCTCATGGCAGCAGCCTGGTACACTCCTCTCGCCGTCGGCGGCATG
TTCCTCGCCATCGGCGGCGGCCTCGTCCTACACATCATCCCCAACCGCATTCTCCTCCTCATCTCCGGCTTCGGC
TTCTTCCTCTCCGTCCTCCTCTTCGCCCTCATCCCCGGCCCCGATGACGGGAAGTCCCTCAGCTTCATCTACTGG
GCCTACGTCTTCTCCGCTATGCTGGGCGGCACCCTCGGCATCGATGTCACCTTCAACGTCACAAACGTCTTCATC
ACTACCGCCATGCCCCGTCGGCTGCAGGCAGCCGCCAGCGGCGTCATCAACAGCCTGCTATATCTGGGCGTCGCC
TTCTGGCTCGGCGTCGCACAGACAGCCATCTCGACCGCCGATGAGAGACAAGAGGGGGGCATCAAGCCCGAGGCT
CAGTACCGCATTGCCTTTTGGACGGGCGTCGGGCTCGCGGCTGTTGGGCTGCTGCTGACGGCTAGCATAAAAATG
GGACAGGCGTCAGCTGGTCTGACGGCTGACGAGAGGCTAGCGATAGAGGACGAGGAGAGAAGCGTGAGTGGTTAA
Gene >Ophcf2|04682
ATGAAGGTTACCTCGCTCCTCCAGCGACTCAAGGCTGGTGAGCCCGTCCAGAAACCTGAAAGTGTGCGCCCTCCG
TCGACAAGCCATGTCATCCCGTCGTCATCGGGTGACGATAGCGACGGTGGCGCCCTCGTCACCGACGTCAAGTTT
CTCGGCCGGGCCCGTCCGCTCGTTTTCTCAGGCCCCCTCGCTGAGGCCGGCTTCATCTTCACTGTCGTTCTCTCC
ATGATGACGAGCGAGTACTTCGTCGGCGGCTTCGACCTCATTCTTCCCTCCATCGCCGAGGCGCTACACATGCCA
CCCGCAGCCCGCACTTGGCCCGCCGGCGTCGTGACGCTGACGACAGCCTCGCTGCTACAGCCCTTTGCCCGCCTC
TGCGACATGTACGGCAGCCGGCGTGTCTTTCTCTATGGCCAGGCCTGGCTGCTAGCCTGGTCCGTCGTCACCGGC
TTCAGCGTCAACACCACCATGCTCATCGTCTGCCGCGCCATGCAGGGCATCGGCGCTGCCGCCTTTCTACCGGCC
GGTCTCGCCCTACTAGGCCACACGTACCGGCCTGGTCCGCGCAAGAATGTGGCCTTTTCCATCTATGGCGCCTTC
GCCTGCGTCGGCTTCTACTTTGGCATCTTCCTCGGCGCCCTGGCGGCGGAGTTCATGACCTGGAGATGGTACTTT
TGGTTCGGCGCCGTCGCCTGCCTCATCACCCTGGCCTCTGGCCTACTTACGATCCCTCGCGACCTCTCGGACGTG
AATCCGGACGCGGCCATGGACTGGTTAGGCGTCTGCACCATCGTCCCGGGCCTCGTCCTCGTCGTCTTTGCCTTT
ACCGACGCCGGCGACGCCTTCGGAGGCTGGCGCAATCCATACATCTTCGTGACGCTCATCGTCGGCGTCTTATTC
CTCGCCGCAGCCGTCTACGTGCAGGGCTGGGTCTCGGCTCAGCCGTTGCTGCCGCCGGCTCTGTTCAAGCCCAAG
TACATGAAGCGGCTGATGCTGTCGCTGTTTTGCTACTACGGCGTGTTTGGAATCTTTCTTTTGTACACGAGCTTC
TAGTACGTTCGACTTCATCTCCTGAAGCAATGAAGAAGACGATGGCTAACAAATCGAAAACAGCATCGAGAACAC
CCTCGGCGTCAAGCCTCTCATGGCAGCAGCCTGGTACACTCCTCTCGCCGTCGGCGGCATGTTCCTCGCCATCGG
CGGCGGCCTCGTCCTACACATCATCCCCAACCGCATTCTCCTCCTCATCTCCGGCTTCGGCTTCTTCCTCTCCGT
CCTCCTCTTCGCCCTCATCCCCGGCCCCGATGACGGGAAGTCCCTCAGCTTCATCTACTGGGCCTACGTCTTCTC
CGCTATGCTGGGCGGCACCCTCGGCATCGATGTCACCTTCAACGTCACAAACGTCTTCATCACTACCGCCATGCC
CCGTCGGCTGCAGGCAGCCGCCAGCGGCGTCATCAACAGCCTGCTATATCTGGGCGTCGCCTTCTGGCTCGGCGT
CGCACAGACAGCCATCTCGACCGCCGATGAGAGACAAGAGGGGGGCATCAAGCCCGAGGCTCAGTACCGCATTGC
CTTTTGGACGGGCGTCGGGCTCGCGGCTGTTGGGCTGCTGCTGACGGCTAGCATAAAAATGGGACAGGCGTCAGC
TGGTCTGACGGCTGACGAGAGGCTAGCGATAGAGGACGAGGAGAGAAGCGTGAGTGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail