Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04681
Gene name
Locationscaffold_05:190845..191918
Strand-
Gene length (bp)1073
Transcript length (bp)897
Coding sequence length (bp)897
Protein length (aa) 299

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01083 Cutinase Cutinase 2.5E-43 22 221
PF08237 PE-PPE PE-PPE domain 8.9E-05 64 114

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04681
MRSSVLVVAALIAGTAAESCGSGLYIIVARGTSEVQGSGIIGSVADGIAKEIAGSQVAPLQYPASLSDPVYQDSV
AAGVQQMQKTLRNYVNNCPRSKLAILGYSQGAQVAMDALCGSVSFEGFENSTAISSSLFKNNIVAVALFGDPSHV
ANVTYDRGTSIRNGIFNRTSSSVQDCKAFSDRIVSYCDVGDIYCDVGDNKMVHGLYVSRYGAEVQHFVVDRYSKD
AAMTRNATKPSSTAPSSSAASLSSTPTSSSTASPSAGDGGAGRAGERTSGGTRANGGFGLAALSVGFLVAVAM*
Coding >Ophcf2|04681
ATGCGTTCAAGCGTCCTAGTCGTGGCCGCTCTAATCGCCGGCACTGCCGCCGAGTCGTGCGGATCCGGCCTCTAC
ATCATCGTCGCCCGCGGCACCAGCGAAGTCCAAGGCTCAGGCATCATAGGCAGCGTGGCCGACGGCATCGCCAAA
GAGATTGCCGGCTCTCAGGTCGCACCTCTGCAGTACCCGGCCAGCCTGTCGGACCCTGTCTACCAGGACTCCGTC
GCTGCAGGTGTTCAGCAGATGCAGAAGACATTGAGGAATTATGTCAATAACTGCCCGCGTTCCAAGTTGGCCATT
TTGGGCTACTCGCAGGGCGCTCAAGTGGCTATGGATGCCCTATGCGGCTCTGTGAGTTTCGAAGGCTTTGAGAAC
TCGACGGCTATCAGTAGCAGCTTGTTCAAGAATAACATCGTGGCCGTCGCCTTGTTCGGCGATCCATCCCACGTT
GCCAACGTCACGTACGACAGGGGAACTAGCATCCGAAACGGGATCTTCAATCGCACTAGCAGCTCGGTGCAGGAT
TGCAAGGCCTTTTCCGACCGCATCGTCTCATACTGCGACGTGGGGGACATTTACTGCGATGTGGGTGACAACAAG
ATGGTGCACGGCCTTTATGTATCCCGCTACGGCGCCGAGGTGCAGCATTTCGTCGTCGACAGGTACAGCAAGGAC
GCAGCCATGACGCGAAACGCGACCAAACCCTCCAGCACGGCCCCGTCATCGAGCGCGGCTTCGCTTTCGAGCACG
CCCACGTCTTCGAGCACGGCCTCGCCAAGTGCGGGCGACGGAGGGGCGGGCCGAGCCGGTGAAAGGACCTCGGGA
GGGACGAGAGCGAACGGAGGATTTGGTCTCGCGGCCTTGTCTGTCGGTTTTCTGGTGGCTGTGGCGATGTGA
Transcript >Ophcf2|04681
ATGCGTTCAAGCGTCCTAGTCGTGGCCGCTCTAATCGCCGGCACTGCCGCCGAGTCGTGCGGATCCGGCCTCTAC
ATCATCGTCGCCCGCGGCACCAGCGAAGTCCAAGGCTCAGGCATCATAGGCAGCGTGGCCGACGGCATCGCCAAA
GAGATTGCCGGCTCTCAGGTCGCACCTCTGCAGTACCCGGCCAGCCTGTCGGACCCTGTCTACCAGGACTCCGTC
GCTGCAGGTGTTCAGCAGATGCAGAAGACATTGAGGAATTATGTCAATAACTGCCCGCGTTCCAAGTTGGCCATT
TTGGGCTACTCGCAGGGCGCTCAAGTGGCTATGGATGCCCTATGCGGCTCTGTGAGTTTCGAAGGCTTTGAGAAC
TCGACGGCTATCAGTAGCAGCTTGTTCAAGAATAACATCGTGGCCGTCGCCTTGTTCGGCGATCCATCCCACGTT
GCCAACGTCACGTACGACAGGGGAACTAGCATCCGAAACGGGATCTTCAATCGCACTAGCAGCTCGGTGCAGGAT
TGCAAGGCCTTTTCCGACCGCATCGTCTCATACTGCGACGTGGGGGACATTTACTGCGATGTGGGTGACAACAAG
ATGGTGCACGGCCTTTATGTATCCCGCTACGGCGCCGAGGTGCAGCATTTCGTCGTCGACAGGTACAGCAAGGAC
GCAGCCATGACGCGAAACGCGACCAAACCCTCCAGCACGGCCCCGTCATCGAGCGCGGCTTCGCTTTCGAGCACG
CCCACGTCTTCGAGCACGGCCTCGCCAAGTGCGGGCGACGGAGGGGCGGGCCGAGCCGGTGAAAGGACCTCGGGA
GGGACGAGAGCGAACGGAGGATTTGGTCTCGCGGCCTTGTCTGTCGGTTTTCTGGTGGCTGTGGCGATGTGA
Gene >Ophcf2|04681
ATGCGTTCAAGCGTCCTAGTCGTGGCCGCTCTAATCGCCGGCACTGCCGCCGAGTCGTGCGGATCCGGCCTCTAC
ATCATCGTCGCCCGCGGCACCAGCGAAGTCCAAGGCTCAGGCATCATAGGCAGCGTGGCCGACGGCATCGCCAAA
GAGATTGCCGGCTCTCAGGTCGCACCTCTGCAGTACCCGGCCAGCCTGTCGGACCCTGTCTACCAGGACTCCGTC
GCTGCAGGTGTTCAGCAGATGCAGAAGACATTGAGGAATTATGTCAATAACTGCCCGCGTTCCAAGTTGGCCATT
TTGGGCTACTCGCAGGTACCGACTACCGTCTCTCGTCAGTCTTAATCGTGTCTGAATTGATGGCGTCCAGGGCGC
TCAAGTGGCTATGGATGCCCTATGCGGCTCTGTGAGTTTCGAAGGCTTTGAGAACTCGACGGCTATCAGTAGCAG
CTTGTTCAAGAATAACAGTTGGTGCCTCGACTCCCATCTCTCCAGCTCGGCTTCTCTGACTCTCCTTGTCGTCAG
TCGTGGCCGTCGCCTTGTTCGGCGATCCATCCCACGTTGCCAACGTCACGTACGACAGGGGAACTAGCATCCGAA
ACGGGGTACGTTAGCGGATCGGAAATCAAGTGGCTCGAGACAAACGTGTGAGACTGACTGATCGGCAGATCTTCA
ATCGCACTAGCAGCTCGGTGCAGGATTGCAAGGCCTTTTCCGACCGCATCGTCTCATACTGCGACGTGGGGGACA
TTTACTGCGATGTGGGTGACAACAAGATGGTGCACGGCCTTTATGTATCCCGCTACGGCGCCGAGGTGCAGCATT
TCGTCGTCGACAGGTACAGCAAGGACGCAGCCATGACGCGAAACGCGACCAAACCCTCCAGCACGGCCCCGTCAT
CGAGCGCGGCTTCGCTTTCGAGCACGCCCACGTCTTCGAGCACGGCCTCGCCAAGTGCGGGCGACGGAGGGGCGG
GCCGAGCCGGTGAAAGGACCTCGGGAGGGACGAGAGCGAACGGAGGATTTGGTCTCGCGGCCTTGTCTGTCGGTT
TTCTGGTGGCTGTGGCGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail