Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04670
Gene name
Locationscaffold_05:168120..169217
Strand+
Gene length (bp)1097
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09011 HMG_box_2 HMG-box domain 6.6E-08 235 294
PF00505 HMG_box HMG (high mobility group) box 1.5E-07 236 301

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.0848 0.1287 0.0882 0.0574 0.9014 0.1376 0.0186 0.013 0.0507 0.004

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3032
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6831
Ophiocordyceps australis map64 (Brazil) OphauB2|5482
Ophiocordyceps camponoti-floridani Ophcf2|04670 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5732
Ophiocordyceps kimflemingae Ophio5|3300
Ophiocordyceps subramaniannii Hirsu2|5235

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04670
MFMSLSRVVARRVTSTGLVWASVSARRVVPVLSARAFSGSAFVLAPTTAKTKKAPAAKKAAATKKSTAGSKKSTA
TAAKKKKAPAKAKAKAKKPAAAAKKKKKVVVKKSKKKQMTPEEREKAKLRYLKMLSLWRMPRCRPATPWSLYVAN
NFPAGNDETSTAKFNRLFAEYSKSTAAEMEAFKAQTEANEIYNKKELEKWIKSYPVEVVYLANIARRRLVRILKR
GAKFIPDDRQPKRPRNAMASFLATQLAGKKGAGDRQTDIFKSAVEKWKAMSDAEKKPYHDQAKAESERCKGRHEK
YTQSAIRYWENNMPKRRPTVPRTRADLIKAKAKAKTTNA*
Coding >Ophcf2|04670
ATGTTCATGTCGTTGAGCCGCGTTGTCGCCCGCCGGGTGACGTCGACGGGCCTCGTCTGGGCTTCCGTCTCGGCC
CGTCGCGTCGTCCCCGTCTTGTCGGCGCGTGCCTTTTCTGGCTCGGCTTTTGTTCTCGCTCCGACGACGGCAAAG
ACAAAGAAGGCGCCGGCTGCCAAGAAAGCAGCAGCTACCAAGAAAAGTACTGCCGGCTCTAAGAAGTCGACTGCA
ACCGCCGCCAAGAAGAAGAAGGCTCCGGCGAAGGCCAAGGCCAAGGCCAAGAAGCCGGCTGCTGCCGCTAAGAAG
AAGAAGAAGGTGGTCGTGAAAAAGTCGAAGAAGAAGCAAATGACCCCCGAAGAAAGGGAAAAGGCCAAGCTGCGC
TACCTCAAGATGCTGTCTTTGTGGAGGATGCCGAGATGCCGGCCTGCTACGCCGTGGTCGCTATATGTGGCCAAC
AACTTTCCCGCAGGGAATGACGAGACCTCGACCGCGAAGTTCAATCGTCTCTTTGCCGAATACTCCAAGTCTACC
GCCGCAGAGATGGAGGCCTTTAAAGCTCAGACAGAAGCCAACGAGATATATAACAAGAAGGAGCTCGAAAAGTGG
ATCAAGTCGTACCCCGTCGAGGTCGTCTACCTGGCCAACATCGCTCGCCGTCGTCTCGTTCGCATTTTGAAAAGA
GGAGCCAAATTTATCCCAGACGATCGTCAGCCCAAGCGCCCGCGCAACGCCATGGCGTCCTTTCTGGCGACGCAG
CTTGCGGGAAAAAAGGGTGCGGGAGACCGCCAGACTGATATCTTCAAATCCGCCGTCGAGAAGTGGAAGGCAATG
AGTGACGCTGAGAAGAAGCCGTATCATGATCAAGCCAAGGCTGAAAGTGAGCGCTGCAAGGGCCGACACGAAAAG
TACACCCAGAGTGCCATTCGATACTGGGAGAATAATATGCCCAAGCGCAGGCCCACGGTCCCGAGAACACGTGCA
GACCTTATCAAGGCAAAGGCAAAGGCAAAGACGACCAACGCCTAG
Transcript >Ophcf2|04670
ATGTTCATGTCGTTGAGCCGCGTTGTCGCCCGCCGGGTGACGTCGACGGGCCTCGTCTGGGCTTCCGTCTCGGCC
CGTCGCGTCGTCCCCGTCTTGTCGGCGCGTGCCTTTTCTGGCTCGGCTTTTGTTCTCGCTCCGACGACGGCAAAG
ACAAAGAAGGCGCCGGCTGCCAAGAAAGCAGCAGCTACCAAGAAAAGTACTGCCGGCTCTAAGAAGTCGACTGCA
ACCGCCGCCAAGAAGAAGAAGGCTCCGGCGAAGGCCAAGGCCAAGGCCAAGAAGCCGGCTGCTGCCGCTAAGAAG
AAGAAGAAGGTGGTCGTGAAAAAGTCGAAGAAGAAGCAAATGACCCCCGAAGAAAGGGAAAAGGCCAAGCTGCGC
TACCTCAAGATGCTGTCTTTGTGGAGGATGCCGAGATGCCGGCCTGCTACGCCGTGGTCGCTATATGTGGCCAAC
AACTTTCCCGCAGGGAATGACGAGACCTCGACCGCGAAGTTCAATCGTCTCTTTGCCGAATACTCCAAGTCTACC
GCCGCAGAGATGGAGGCCTTTAAAGCTCAGACAGAAGCCAACGAGATATATAACAAGAAGGAGCTCGAAAAGTGG
ATCAAGTCGTACCCCGTCGAGGTCGTCTACCTGGCCAACATCGCTCGCCGTCGTCTCGTTCGCATTTTGAAAAGA
GGAGCCAAATTTATCCCAGACGATCGTCAGCCCAAGCGCCCGCGCAACGCCATGGCGTCCTTTCTGGCGACGCAG
CTTGCGGGAAAAAAGGGTGCGGGAGACCGCCAGACTGATATCTTCAAATCCGCCGTCGAGAAGTGGAAGGCAATG
AGTGACGCTGAGAAGAAGCCGTATCATGATCAAGCCAAGGCTGAAAGTGAGCGCTGCAAGGGCCGACACGAAAAG
TACACCCAGAGTGCCATTCGATACTGGGAGAATAATATGCCCAAGCGCAGGCCCACGGTCCCGAGAACACGTGCA
GACCTTATCAAGGCAAAGGCAAAGGCAAAGACGACCAACGCCTAG
Gene >Ophcf2|04670
ATGTTCATGTCGTTGAGCCGCGTTGTCGCCCGCCGGGTGACGTCGACGGGCCTCGTCTGGGCTTCCGTCTCGGCC
CGTCGCGTCGTCCCCGTCTTGTCGGCGCGTGCCTTTTCTGGCTCGGCTTTTGTTCTCGCTCCGACGACGGCAAAG
ACAAAGAAGGCGCCGGCTGCCAAGAAAGCAGCAGCTACCAAGAAAAGTACTGCCGGCTCTAAGAAGTCGACTGCA
ACCGCCGCCAAGAAGAAGAAGGCTCCGGCGAAGGCCAAGGCCAAGGCCAAGAAGCCGGCTGCTGCCGCTAAGAAG
AAGAAGAAGGTGGTCGTGAAAAAGTCGAAGAAGAAGCAAATGACCCCCGAAGAAAGGGAAAAGGCCAAGCTGCGC
TACCTCAAGATGCTGTCTTTGTGGAGGATGCCGAGATGCCGGCCTGCTACGCCGTGGTCGCTATATGTGGCCAAC
AACTTTCCCGCAGGGAATGACGAGACCTCGACCGCGAAGTTCAATCGTCTCTTTGCCGAATACTCCAAGTCTACC
GCCGCAGAGATGGAGGTAGGATATCTCTCTGTTTTGGTCTTTACCGCGCAGGCTTTCCCTTGCTGACCGAGGCCT
CGTTCATTTTCTCCCAGGCCTTTAAAGCTCAGACAGAAGCCAACGAGATATATAACAAGAAGGAGCTCGAAAAGT
GGATCAAGTCGTACCCCGTCGAGGTCGTCTACCTGGCCAACATCGCTCGCCGTCGTCTCGTTCGCATTTTGAAAA
GAGGAGCCAAATTTATCCCAGACGATCGTCAGCCCAAGCGCCCGCGCAACGCCATGGCGTCCTTTCTGGCGACGC
AGCTTGCGGGAAAAAAGGGTGCGGGAGACCGCCAGACTGATATCTTCAAATCCGCCGTCGAGAAGTGGAAGGCAA
TGAGTGACGCTGAGAAGAAGCCGTATCATGATCAAGCCAAGGCTGAAAGTGAGCGCTGCAAGGGCCGACACGAAA
AGTACACCCAGAGTGCCATTCGATACTGGGAGAATAATATGCCCAAGCGCAGGCCCACGGTCCCGAGAACACGTG
CAGACCTTATCAAGGCAAAGGCAAAGGCAAAGACGACCAACGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail