Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04664
Gene name
Locationscaffold_05:151456..157973
Strand-
Gene length (bp)6517
Transcript length (bp)6444
Coding sequence length (bp)6444
Protein length (aa) 2148

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18995 PRT6_C Proteolysis_6 C-terminal 6.7E-157 1640 2124
PF02207 zf-UBR Putative zinc finger in N-recognin (UBR box) 1.8E-16 87 155
PF02617 ClpS ATP-dependent Clp protease adaptor protein ClpS 6.1E-06 236 285

GO

GO Term Description Terminal node
GO:0030163 protein catabolic process Yes
GO:0008270 zinc ion binding Yes
GO:0019538 protein metabolic process No
GO:0009056 catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043170 macromolecule metabolic process No
GO:0046914 transition metal ion binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0009057 macromolecule catabolic process No
GO:1901575 organic substance catabolic process No
GO:0043167 ion binding No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.4993 0.6928 0.0756 0.0779 0.0882 0.0066 0.1398 0.2992 0.11 0.008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3028
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5816
Ophiocordyceps australis map64 (Brazil) OphauB2|5476
Ophiocordyceps camponoti-floridani Ophcf2|04664 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5652
Ophiocordyceps kimflemingae Ophio5|3306
Ophiocordyceps subramaniannii Hirsu2|5228

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04664
METPPSTQEQQLCQLLADLPLRFNYRYTVDASRELLINLFWSLAGGNHDYLRLLFPSGKLCDSLKLGDAQGAVEG
AEYTEGARGKRCGHIFRPGEASYMCRTCGIDETCCLCSRCFEATDHTGHIVRIQISVGNSGCCDCGDEEAWRTPL
LCTIHSDLDKGPDKGKHREAAALPEDLVANLQMTIGRVFDYICDVVSCSPEQLRQSKTKASISYDEQSSRLASKY
YGPNADACGDFALILWNDEKHTVQEVEDQVARACRKTARDASNNAWETDNVGRSILTFSTDIDELLQMARIMESI
RVTVTIRSARDTFRERMCGTLVEWLSDISVCSVGHDSHILRQTVCEQIMLPWRRGSRASNTLGLIDDEEEDEQSM
APIRGLNTRFILAVTGNPAGLEIAIGAGDDSDDSDDNGAGNGGEDEGGDDGAGDDADMDDGDAENRSGSSSVAGR
GEDEDEDVMMVDARGEVADLGMNWNQADQALEEDEATMAGYPPPPPPPPPPPPPAPGRRDRDGTPSDSDTAEPLI
APAIFAKANVHIPKTPGKTERATPRPGRYWVETPALYTRRDNVPPAENVFQRVRLDWLLLFDLRMWKKVRNDLRA
LYISTVVQIPEFKRVLALRFASLYTILAQLYLVGDREPDHSIINLSLQMLTVPSITAEVVERGNFLSSLLAILYT
FLTTRQVGHPWDVSPDAFLAFDSGSVTNRRMYHFYQDLKYLFSSTHVRERIRSEPRYLMQFLDLVKLHQCIGPNV
RAVTEHVEYEADTWITASLVTRQINSQARNLAEAFRDCPPDEVHYLQRAIRFTAKTVILNSVGAERQRFKQAEIK
DDEVKFKTLSDFEFEADDASYNVVRFVVEKDPISFHHALHYTLSWLIECGRSIPASSMRTLLSFTAHELRSKPRL
MGRSQLPKTELSAEDYLLVAFDFPLRVCAWLAQIKANMWVRNGISLRHQAGTYRGVQQRDVCHHRDIFLLQTAMV
VCDPSRVLASIIDRFGMDGWVKGLFALNSEAQDDNQHLDVVEDMIHLLIVLLSDRTPLIAPEDEPNSRTLAMRRD
LTHVLCFKPLSFNEICNKLPEKYQEQEDFHRFLDEMATFKPPEGVSDVGTFELRHEFIEDIDPYIAHYNKNQREE
SEMAYRKKMAKKTGKTVDEIVYEPKHRPIPSGLFEKLGDFTGTGVFAQIIFYSLLYPLVAHRHTPSVPLTRLETF
LQVVLHLILVAILEDGTSEDDESATNTSSSFVYNALTKQARCRFLPDASNARTIVSLLNLLSTKEQFKSAHPKVA
LVLKRLKQKRPRALEAAFNNLGIAVDRINTASPANSSAEEERERRKKAALSRQARVMAQFQQQQNRFLENQGAID
WGSDLDDEEEVQQTEDRKHDWKYPTGTCILCQEDADDRHLYGTFALLCESRIVRQTDFQDADLVREASQTPCSLD
RSADDIRPFGIARENRKMVEKLNHTGEVFLAERQTIGKGYPGALARPGPVASGCGHMMHFHCFQMYCDATRRRHD
HQIARHHPEDTKRNEFVCPLCKALGNAFLPIVWRGLEESYPGYLQPQGSFADFLGKHMGHSYWLGVGKARQTDAP
GLPELHTPSTPGSLLEMMRRPGLAGIMESGASPSRDISAGASSSSSGPPVHSEIVQDLMAAYRRLRDTIRKNNLS
TKEAIGVKSEHEEELHFSDTLVLAVGFTISSVEIQQRGVEAQLGMTLLDKIPDQVLTHLRVLSETASSYATVGAQ
VSASKSRIEGEFRRDSDRQHCQLFIARYLGTSSPESSQPTESYTPLLTLDPFVLLVECAYGLVRAHRAEISHLVR
LCYLAELVKVVYHMGRNMPEALWLGGLRNRRAQTQDAAIHNFACFALQVTECGITCRNTMAMAATEEGPNRGFQQ
PGVDSPEGWYTLAKKYALVFLRKTLLFLYVRYGVDFGSHISPGPDADELDRLTEALRLPSFDEMCASLTENSRLC
GWPGATRDIVSGWVMHQILYPRKQGDPRPSALVVHPAIFELIGLPKTYDTLIEEATRRRCPTTGKDLTDPVICLF
CGELLCSQSTCCQQPAVISNEPTRIGGAQRHVRRCQRNMGVFLNIRKCTTVYLFRQSGSFTAAPYIDKYGETDFQ
LRHGRQLFLNQRRYDTMIRNTVLNHGVPNLISRKLEADINNGGWDTL*
Coding >Ophcf2|04664
ATGGAGACGCCACCGTCCACACAGGAGCAGCAGCTCTGCCAGCTGCTGGCCGATCTGCCCTTGCGTTTCAACTAC
CGCTACACGGTAGACGCGTCGCGCGAGCTTCTCATCAACCTGTTCTGGTCGCTGGCGGGCGGCAACCATGACTAC
CTACGACTCCTCTTCCCCTCGGGCAAGCTGTGCGACAGCCTCAAGCTCGGCGATGCCCAGGGCGCCGTCGAAGGG
GCCGAATACACAGAAGGTGCTCGCGGGAAACGCTGTGGCCACATCTTCAGGCCCGGCGAGGCCTCGTACATGTGC
CGAACCTGTGGCATCGACGAGACGTGCTGTCTGTGCAGCAGATGCTTCGAAGCGACCGACCACACGGGTCACATT
GTCCGTATACAAATATCCGTTGGCAACAGCGGCTGTTGCGACTGCGGAGACGAAGAGGCCTGGCGGACGCCTCTG
CTCTGCACCATTCATTCCGACTTGGACAAAGGCCCGGACAAGGGCAAGCATCGGGAGGCTGCCGCCCTGCCCGAG
GATCTCGTGGCTAATCTCCAGATGACCATCGGGAGAGTCTTTGACTACATCTGCGACGTCGTCTCGTGTTCTCCC
GAGCAGCTGCGTCAGTCCAAGACCAAGGCGTCCATCTCCTATGACGAACAGTCGTCCCGCCTAGCTTCTAAATAC
TACGGCCCCAACGCCGACGCCTGCGGCGATTTCGCCCTCATACTCTGGAATGATGAAAAGCACACTGTCCAGGAA
GTGGAGGACCAGGTGGCCCGAGCCTGTCGAAAGACGGCCCGCGACGCCTCGAACAACGCCTGGGAGACGGATAAC
GTTGGGCGCAGCATACTGACATTCTCGACCGACATTGACGAGCTCCTGCAAATGGCCAGGATCATGGAGTCCATA
CGTGTTACCGTCACCATCCGCTCGGCCAGAGACACTTTTCGCGAGAGGATGTGTGGAACTCTGGTGGAATGGCTG
AGCGACATATCCGTCTGCTCCGTCGGTCACGACAGTCACATACTTAGGCAGACAGTTTGTGAGCAAATCATGCTG
CCGTGGCGGCGGGGAAGCCGTGCCTCCAACACTCTGGGCCTTATCGATGACGAGGAGGAGGATGAGCAGAGCATG
GCGCCGATACGCGGGCTGAACACGCGCTTCATCTTGGCAGTCACCGGAAACCCCGCCGGCCTGGAGATTGCCATC
GGGGCGGGCGACGACAGCGACGACAGCGACGACAACGGCGCCGGCAATGGCGGTGAGGACGAAGGCGGAGACGAT
GGTGCTGGGGACGATGCGGACATGGATGACGGCGACGCGGAGAACCGGTCCGGATCGAGCTCCGTCGCGGGCCGT
GGCGAGGATGAAGATGAGGATGTCATGATGGTAGACGCTAGAGGCGAAGTGGCCGACTTGGGAATGAACTGGAAC
CAAGCAGACCAGGCCCTGGAGGAGGATGAGGCAACCATGGCAGGCTATCCGCCACCGCCGCCACCGCCGCCGCCA
CCGCCGCCGCCGGCGCCAGGCCGTCGAGACCGGGACGGAACGCCGTCAGATTCGGACACGGCAGAGCCGCTCATC
GCACCGGCTATCTTCGCCAAGGCTAACGTCCACATCCCCAAGACACCTGGCAAGACGGAGAGGGCCACTCCCCGG
CCTGGTAGATATTGGGTCGAGACGCCGGCATTGTATACTCGACGCGACAATGTGCCGCCGGCCGAGAACGTCTTT
CAGCGTGTCCGCCTCGACTGGCTGCTTCTCTTTGATCTGCGCATGTGGAAGAAGGTCCGGAACGACCTGCGTGCG
CTCTACATATCCACCGTTGTGCAGATTCCAGAGTTCAAGCGCGTCCTGGCTCTGCGTTTCGCGAGCCTCTATACC
ATCCTCGCCCAGCTATACCTCGTCGGCGACCGTGAACCGGATCACTCCATCATCAACCTCTCTCTCCAGATGCTG
ACGGTTCCCTCCATAACGGCCGAGGTGGTCGAGCGAGGCAACTTCTTGAGCAGCCTGCTGGCCATTCTGTACACC
TTCCTGACGACCAGGCAGGTCGGCCATCCTTGGGACGTGTCCCCGGACGCCTTCTTGGCCTTTGACAGCGGCTCC
GTCACCAACCGGCGCATGTACCATTTCTATCAGGACCTCAAGTATCTCTTCAGCTCGACGCATGTGCGGGAACGG
ATCCGGTCCGAGCCTCGATACCTGATGCAATTCTTAGATCTGGTGAAGCTGCATCAGTGCATAGGCCCCAACGTA
CGGGCCGTGACAGAGCATGTCGAGTACGAGGCCGACACGTGGATCACGGCTTCGCTGGTGACTCGCCAGATCAAC
TCGCAGGCTCGAAACCTGGCCGAGGCCTTCCGAGACTGTCCGCCCGACGAAGTTCACTATCTGCAGCGGGCGATA
CGCTTCACTGCCAAGACGGTCATCCTCAACTCCGTCGGGGCGGAGCGCCAGAGGTTTAAGCAGGCAGAGATCAAG
GATGACGAGGTCAAGTTCAAGACGTTGAGTGATTTCGAATTCGAGGCCGACGACGCTTCCTACAACGTCGTGAGA
TTCGTGGTCGAGAAGGACCCCATCAGCTTCCACCACGCCCTGCACTACACCCTCTCTTGGCTCATCGAGTGCGGC
AGGTCGATACCCGCGTCGAGCATGCGGACCCTCCTGAGCTTCACCGCCCACGAGCTCAGGTCGAAGCCCAGGCTG
ATGGGCCGCTCCCAGCTTCCCAAGACGGAGCTCAGTGCGGAAGACTATCTTTTGGTCGCGTTCGACTTTCCCCTC
CGAGTCTGTGCCTGGCTGGCTCAGATCAAGGCCAATATGTGGGTGCGTAACGGCATCAGTCTGCGGCACCAGGCC
GGCACGTATCGCGGCGTCCAACAACGGGACGTCTGCCACCATCGAGACATCTTTCTTCTGCAGACGGCCATGGTC
GTGTGCGATCCGAGCCGGGTGCTGGCGTCCATCATCGACCGCTTCGGCATGGACGGCTGGGTCAAGGGGCTCTTC
GCGCTCAACTCGGAGGCCCAAGACGATAACCAGCATCTCGACGTGGTTGAGGACATGATTCACCTGCTCATAGTA
CTCCTCAGCGATCGCACCCCTCTGATTGCGCCCGAGGACGAGCCTAACTCGCGGACGCTCGCCATGCGCCGCGAC
CTCACTCACGTTCTGTGCTTCAAGCCCCTGTCCTTCAACGAGATCTGCAACAAGCTTCCCGAAAAGTACCAAGAA
CAGGAGGACTTTCATCGGTTTCTCGACGAAATGGCCACCTTCAAGCCGCCCGAGGGCGTCTCTGACGTGGGCACG
TTTGAACTGCGGCACGAGTTTATCGAGGACATCGACCCGTACATTGCGCATTACAACAAGAACCAGCGGGAAGAG
TCGGAGATGGCGTATCGGAAGAAGATGGCCAAGAAGACGGGAAAGACGGTGGATGAGATTGTCTACGAGCCCAAG
CATCGGCCCATACCGTCGGGCCTGTTTGAGAAGCTGGGCGACTTCACCGGCACCGGCGTCTTTGCCCAGATTATC
TTCTACTCGCTCCTGTATCCGCTCGTCGCTCACCGGCACACGCCGTCGGTGCCCTTGACCAGGCTGGAGACGTTT
CTCCAGGTGGTGCTGCACCTGATTCTCGTCGCCATTCTCGAGGACGGCACGTCGGAGGACGACGAGTCGGCGACG
AACACATCGAGCTCCTTCGTCTACAACGCGCTGACGAAACAGGCGCGCTGCAGATTCTTGCCCGACGCCAGCAAC
GCGAGGACCATTGTGTCGCTGCTCAACCTCCTCTCGACAAAGGAACAGTTCAAGTCGGCCCACCCCAAGGTCGCT
CTCGTGCTTAAGCGGCTAAAGCAGAAGCGACCGAGGGCACTGGAAGCAGCCTTTAACAATCTCGGCATCGCCGTC
GACCGCATCAACACGGCTTCGCCGGCCAATAGCTCAGCCGAGGAGGAGCGCGAGCGCAGGAAGAAGGCGGCGCTG
AGCCGCCAGGCCAGGGTCATGGCACAGTTCCAGCAGCAGCAGAACCGCTTCCTGGAGAACCAGGGCGCCATCGAC
TGGGGCTCCGACCTAGACGACGAGGAAGAGGTGCAGCAGACGGAAGATCGCAAGCACGACTGGAAGTATCCGACC
GGAACTTGCATCCTTTGCCAGGAGGACGCCGACGATCGCCATCTGTACGGCACCTTTGCCCTCTTGTGCGAGAGT
CGCATCGTGCGCCAGACCGACTTCCAAGACGCCGACCTGGTGAGGGAAGCGTCGCAGACGCCGTGCAGCCTCGAC
CGATCGGCGGATGATATTCGACCCTTTGGCATCGCGCGGGAGAACCGCAAAATGGTGGAGAAGCTGAACCACACA
GGAGAGGTGTTCCTGGCCGAGCGCCAGACCATCGGCAAGGGATATCCGGGCGCGCTGGCGAGGCCCGGGCCCGTG
GCGAGCGGGTGCGGACACATGATGCACTTTCACTGCTTCCAGATGTACTGCGATGCCACGAGACGCAGACACGAT
CACCAGATCGCCCGTCATCATCCGGAGGACACGAAGCGCAACGAGTTTGTGTGCCCGCTCTGCAAGGCGTTGGGC
AATGCCTTCTTGCCCATCGTCTGGAGGGGACTGGAGGAGTCGTATCCCGGCTATCTCCAACCCCAGGGCTCGTTT
GCCGACTTCCTGGGCAAGCACATGGGCCACTCGTACTGGCTCGGAGTGGGCAAGGCCAGGCAGACGGACGCACCG
GGCCTTCCAGAGCTGCACACTCCCAGCACGCCCGGGAGCCTGTTGGAGATGATGAGGAGACCCGGCTTGGCTGGC
ATAATGGAGTCTGGGGCATCGCCATCGAGGGACATATCCGCCGGCGCAAGCTCGTCGTCGTCGGGGCCGCCCGTC
CACAGCGAGATCGTCCAGGACCTGATGGCCGCGTACCGACGCCTGCGGGACACGATCCGCAAGAACAACCTCAGC
ACCAAGGAGGCGATCGGCGTCAAGTCGGAGCACGAAGAAGAATTGCACTTCAGCGACACGCTCGTTCTCGCCGTC
GGCTTCACCATATCGTCGGTAGAGATACAGCAGCGCGGGGTCGAGGCGCAGCTTGGCATGACGCTGCTGGACAAG
ATCCCTGATCAGGTCCTGACGCACCTGAGGGTCCTGTCGGAGACGGCGTCGTCCTACGCGACGGTCGGCGCCCAG
GTTTCGGCCTCCAAGAGCCGGATCGAGGGCGAGTTCCGGCGGGACAGCGACCGGCAGCACTGCCAGCTCTTCATC
GCGCGTTATCTGGGCACCAGCTCGCCCGAGTCGTCGCAGCCGACGGAAAGCTACACGCCGCTGCTGACCCTGGAC
CCGTTCGTGTTACTGGTCGAGTGCGCGTACGGGCTGGTACGGGCGCATAGGGCCGAGATCTCGCACCTGGTCAGG
CTGTGCTACCTGGCGGAGCTGGTCAAGGTGGTGTATCACATGGGCCGCAATATGCCCGAGGCTCTCTGGCTCGGC
GGGCTCAGGAACCGACGGGCGCAGACGCAGGACGCTGCCATCCACAACTTTGCCTGCTTCGCCCTCCAGGTGACC
GAGTGCGGCATAACGTGCCGGAACACCATGGCCATGGCCGCGACCGAGGAGGGCCCGAACAGGGGCTTTCAACAG
CCGGGCGTCGACTCGCCCGAGGGCTGGTACACGCTGGCCAAGAAGTACGCCCTGGTGTTTCTGCGCAAGACGCTG
CTGTTCCTGTACGTCCGGTACGGCGTCGATTTTGGCAGCCACATATCGCCGGGCCCGGACGCAGACGAGCTGGAC
CGGCTGACCGAGGCGCTCCGGCTTCCCTCTTTCGACGAGATGTGCGCGTCTTTGACCGAGAACTCTCGCTTGTGC
GGGTGGCCGGGCGCGACGCGCGACATCGTGTCGGGCTGGGTGATGCACCAGATACTGTATCCGCGGAAGCAGGGC
GACCCGCGCCCGTCGGCCCTGGTGGTCCATCCGGCCATATTCGAGCTCATCGGCCTGCCCAAGACGTATGACACG
CTGATTGAGGAGGCGACGAGGCGGCGGTGTCCGACGACGGGCAAGGACTTGACGGACCCCGTCATCTGCCTGTTC
TGCGGCGAGCTGCTCTGTAGTCAGAGCACTTGCTGTCAACAACCGGCCGTCATCAGCAATGAGCCGACCAGGATC
GGCGGCGCGCAGCGACACGTCCGCAGATGCCAGCGCAACATGGGTGTCTTCCTCAACATCCGCAAATGCACGACG
GTCTATCTATTTCGGCAGTCGGGGTCGTTTACGGCGGCGCCTTATATCGACAAGTACGGCGAGACGGACTTTCAG
CTGCGTCACGGACGACAGCTCTTTTTGAATCAGAGGAGATACGACACGATGATACGAAATACGGTTCTTAACCAC
GGGGTTCCGAACCTCATCAGCCGCAAGCTGGAGGCGGATATAAACAATGGCGGATGGGACACGCTGTAA
Transcript >Ophcf2|04664
ATGGAGACGCCACCGTCCACACAGGAGCAGCAGCTCTGCCAGCTGCTGGCCGATCTGCCCTTGCGTTTCAACTAC
CGCTACACGGTAGACGCGTCGCGCGAGCTTCTCATCAACCTGTTCTGGTCGCTGGCGGGCGGCAACCATGACTAC
CTACGACTCCTCTTCCCCTCGGGCAAGCTGTGCGACAGCCTCAAGCTCGGCGATGCCCAGGGCGCCGTCGAAGGG
GCCGAATACACAGAAGGTGCTCGCGGGAAACGCTGTGGCCACATCTTCAGGCCCGGCGAGGCCTCGTACATGTGC
CGAACCTGTGGCATCGACGAGACGTGCTGTCTGTGCAGCAGATGCTTCGAAGCGACCGACCACACGGGTCACATT
GTCCGTATACAAATATCCGTTGGCAACAGCGGCTGTTGCGACTGCGGAGACGAAGAGGCCTGGCGGACGCCTCTG
CTCTGCACCATTCATTCCGACTTGGACAAAGGCCCGGACAAGGGCAAGCATCGGGAGGCTGCCGCCCTGCCCGAG
GATCTCGTGGCTAATCTCCAGATGACCATCGGGAGAGTCTTTGACTACATCTGCGACGTCGTCTCGTGTTCTCCC
GAGCAGCTGCGTCAGTCCAAGACCAAGGCGTCCATCTCCTATGACGAACAGTCGTCCCGCCTAGCTTCTAAATAC
TACGGCCCCAACGCCGACGCCTGCGGCGATTTCGCCCTCATACTCTGGAATGATGAAAAGCACACTGTCCAGGAA
GTGGAGGACCAGGTGGCCCGAGCCTGTCGAAAGACGGCCCGCGACGCCTCGAACAACGCCTGGGAGACGGATAAC
GTTGGGCGCAGCATACTGACATTCTCGACCGACATTGACGAGCTCCTGCAAATGGCCAGGATCATGGAGTCCATA
CGTGTTACCGTCACCATCCGCTCGGCCAGAGACACTTTTCGCGAGAGGATGTGTGGAACTCTGGTGGAATGGCTG
AGCGACATATCCGTCTGCTCCGTCGGTCACGACAGTCACATACTTAGGCAGACAGTTTGTGAGCAAATCATGCTG
CCGTGGCGGCGGGGAAGCCGTGCCTCCAACACTCTGGGCCTTATCGATGACGAGGAGGAGGATGAGCAGAGCATG
GCGCCGATACGCGGGCTGAACACGCGCTTCATCTTGGCAGTCACCGGAAACCCCGCCGGCCTGGAGATTGCCATC
GGGGCGGGCGACGACAGCGACGACAGCGACGACAACGGCGCCGGCAATGGCGGTGAGGACGAAGGCGGAGACGAT
GGTGCTGGGGACGATGCGGACATGGATGACGGCGACGCGGAGAACCGGTCCGGATCGAGCTCCGTCGCGGGCCGT
GGCGAGGATGAAGATGAGGATGTCATGATGGTAGACGCTAGAGGCGAAGTGGCCGACTTGGGAATGAACTGGAAC
CAAGCAGACCAGGCCCTGGAGGAGGATGAGGCAACCATGGCAGGCTATCCGCCACCGCCGCCACCGCCGCCGCCA
CCGCCGCCGCCGGCGCCAGGCCGTCGAGACCGGGACGGAACGCCGTCAGATTCGGACACGGCAGAGCCGCTCATC
GCACCGGCTATCTTCGCCAAGGCTAACGTCCACATCCCCAAGACACCTGGCAAGACGGAGAGGGCCACTCCCCGG
CCTGGTAGATATTGGGTCGAGACGCCGGCATTGTATACTCGACGCGACAATGTGCCGCCGGCCGAGAACGTCTTT
CAGCGTGTCCGCCTCGACTGGCTGCTTCTCTTTGATCTGCGCATGTGGAAGAAGGTCCGGAACGACCTGCGTGCG
CTCTACATATCCACCGTTGTGCAGATTCCAGAGTTCAAGCGCGTCCTGGCTCTGCGTTTCGCGAGCCTCTATACC
ATCCTCGCCCAGCTATACCTCGTCGGCGACCGTGAACCGGATCACTCCATCATCAACCTCTCTCTCCAGATGCTG
ACGGTTCCCTCCATAACGGCCGAGGTGGTCGAGCGAGGCAACTTCTTGAGCAGCCTGCTGGCCATTCTGTACACC
TTCCTGACGACCAGGCAGGTCGGCCATCCTTGGGACGTGTCCCCGGACGCCTTCTTGGCCTTTGACAGCGGCTCC
GTCACCAACCGGCGCATGTACCATTTCTATCAGGACCTCAAGTATCTCTTCAGCTCGACGCATGTGCGGGAACGG
ATCCGGTCCGAGCCTCGATACCTGATGCAATTCTTAGATCTGGTGAAGCTGCATCAGTGCATAGGCCCCAACGTA
CGGGCCGTGACAGAGCATGTCGAGTACGAGGCCGACACGTGGATCACGGCTTCGCTGGTGACTCGCCAGATCAAC
TCGCAGGCTCGAAACCTGGCCGAGGCCTTCCGAGACTGTCCGCCCGACGAAGTTCACTATCTGCAGCGGGCGATA
CGCTTCACTGCCAAGACGGTCATCCTCAACTCCGTCGGGGCGGAGCGCCAGAGGTTTAAGCAGGCAGAGATCAAG
GATGACGAGGTCAAGTTCAAGACGTTGAGTGATTTCGAATTCGAGGCCGACGACGCTTCCTACAACGTCGTGAGA
TTCGTGGTCGAGAAGGACCCCATCAGCTTCCACCACGCCCTGCACTACACCCTCTCTTGGCTCATCGAGTGCGGC
AGGTCGATACCCGCGTCGAGCATGCGGACCCTCCTGAGCTTCACCGCCCACGAGCTCAGGTCGAAGCCCAGGCTG
ATGGGCCGCTCCCAGCTTCCCAAGACGGAGCTCAGTGCGGAAGACTATCTTTTGGTCGCGTTCGACTTTCCCCTC
CGAGTCTGTGCCTGGCTGGCTCAGATCAAGGCCAATATGTGGGTGCGTAACGGCATCAGTCTGCGGCACCAGGCC
GGCACGTATCGCGGCGTCCAACAACGGGACGTCTGCCACCATCGAGACATCTTTCTTCTGCAGACGGCCATGGTC
GTGTGCGATCCGAGCCGGGTGCTGGCGTCCATCATCGACCGCTTCGGCATGGACGGCTGGGTCAAGGGGCTCTTC
GCGCTCAACTCGGAGGCCCAAGACGATAACCAGCATCTCGACGTGGTTGAGGACATGATTCACCTGCTCATAGTA
CTCCTCAGCGATCGCACCCCTCTGATTGCGCCCGAGGACGAGCCTAACTCGCGGACGCTCGCCATGCGCCGCGAC
CTCACTCACGTTCTGTGCTTCAAGCCCCTGTCCTTCAACGAGATCTGCAACAAGCTTCCCGAAAAGTACCAAGAA
CAGGAGGACTTTCATCGGTTTCTCGACGAAATGGCCACCTTCAAGCCGCCCGAGGGCGTCTCTGACGTGGGCACG
TTTGAACTGCGGCACGAGTTTATCGAGGACATCGACCCGTACATTGCGCATTACAACAAGAACCAGCGGGAAGAG
TCGGAGATGGCGTATCGGAAGAAGATGGCCAAGAAGACGGGAAAGACGGTGGATGAGATTGTCTACGAGCCCAAG
CATCGGCCCATACCGTCGGGCCTGTTTGAGAAGCTGGGCGACTTCACCGGCACCGGCGTCTTTGCCCAGATTATC
TTCTACTCGCTCCTGTATCCGCTCGTCGCTCACCGGCACACGCCGTCGGTGCCCTTGACCAGGCTGGAGACGTTT
CTCCAGGTGGTGCTGCACCTGATTCTCGTCGCCATTCTCGAGGACGGCACGTCGGAGGACGACGAGTCGGCGACG
AACACATCGAGCTCCTTCGTCTACAACGCGCTGACGAAACAGGCGCGCTGCAGATTCTTGCCCGACGCCAGCAAC
GCGAGGACCATTGTGTCGCTGCTCAACCTCCTCTCGACAAAGGAACAGTTCAAGTCGGCCCACCCCAAGGTCGCT
CTCGTGCTTAAGCGGCTAAAGCAGAAGCGACCGAGGGCACTGGAAGCAGCCTTTAACAATCTCGGCATCGCCGTC
GACCGCATCAACACGGCTTCGCCGGCCAATAGCTCAGCCGAGGAGGAGCGCGAGCGCAGGAAGAAGGCGGCGCTG
AGCCGCCAGGCCAGGGTCATGGCACAGTTCCAGCAGCAGCAGAACCGCTTCCTGGAGAACCAGGGCGCCATCGAC
TGGGGCTCCGACCTAGACGACGAGGAAGAGGTGCAGCAGACGGAAGATCGCAAGCACGACTGGAAGTATCCGACC
GGAACTTGCATCCTTTGCCAGGAGGACGCCGACGATCGCCATCTGTACGGCACCTTTGCCCTCTTGTGCGAGAGT
CGCATCGTGCGCCAGACCGACTTCCAAGACGCCGACCTGGTGAGGGAAGCGTCGCAGACGCCGTGCAGCCTCGAC
CGATCGGCGGATGATATTCGACCCTTTGGCATCGCGCGGGAGAACCGCAAAATGGTGGAGAAGCTGAACCACACA
GGAGAGGTGTTCCTGGCCGAGCGCCAGACCATCGGCAAGGGATATCCGGGCGCGCTGGCGAGGCCCGGGCCCGTG
GCGAGCGGGTGCGGACACATGATGCACTTTCACTGCTTCCAGATGTACTGCGATGCCACGAGACGCAGACACGAT
CACCAGATCGCCCGTCATCATCCGGAGGACACGAAGCGCAACGAGTTTGTGTGCCCGCTCTGCAAGGCGTTGGGC
AATGCCTTCTTGCCCATCGTCTGGAGGGGACTGGAGGAGTCGTATCCCGGCTATCTCCAACCCCAGGGCTCGTTT
GCCGACTTCCTGGGCAAGCACATGGGCCACTCGTACTGGCTCGGAGTGGGCAAGGCCAGGCAGACGGACGCACCG
GGCCTTCCAGAGCTGCACACTCCCAGCACGCCCGGGAGCCTGTTGGAGATGATGAGGAGACCCGGCTTGGCTGGC
ATAATGGAGTCTGGGGCATCGCCATCGAGGGACATATCCGCCGGCGCAAGCTCGTCGTCGTCGGGGCCGCCCGTC
CACAGCGAGATCGTCCAGGACCTGATGGCCGCGTACCGACGCCTGCGGGACACGATCCGCAAGAACAACCTCAGC
ACCAAGGAGGCGATCGGCGTCAAGTCGGAGCACGAAGAAGAATTGCACTTCAGCGACACGCTCGTTCTCGCCGTC
GGCTTCACCATATCGTCGGTAGAGATACAGCAGCGCGGGGTCGAGGCGCAGCTTGGCATGACGCTGCTGGACAAG
ATCCCTGATCAGGTCCTGACGCACCTGAGGGTCCTGTCGGAGACGGCGTCGTCCTACGCGACGGTCGGCGCCCAG
GTTTCGGCCTCCAAGAGCCGGATCGAGGGCGAGTTCCGGCGGGACAGCGACCGGCAGCACTGCCAGCTCTTCATC
GCGCGTTATCTGGGCACCAGCTCGCCCGAGTCGTCGCAGCCGACGGAAAGCTACACGCCGCTGCTGACCCTGGAC
CCGTTCGTGTTACTGGTCGAGTGCGCGTACGGGCTGGTACGGGCGCATAGGGCCGAGATCTCGCACCTGGTCAGG
CTGTGCTACCTGGCGGAGCTGGTCAAGGTGGTGTATCACATGGGCCGCAATATGCCCGAGGCTCTCTGGCTCGGC
GGGCTCAGGAACCGACGGGCGCAGACGCAGGACGCTGCCATCCACAACTTTGCCTGCTTCGCCCTCCAGGTGACC
GAGTGCGGCATAACGTGCCGGAACACCATGGCCATGGCCGCGACCGAGGAGGGCCCGAACAGGGGCTTTCAACAG
CCGGGCGTCGACTCGCCCGAGGGCTGGTACACGCTGGCCAAGAAGTACGCCCTGGTGTTTCTGCGCAAGACGCTG
CTGTTCCTGTACGTCCGGTACGGCGTCGATTTTGGCAGCCACATATCGCCGGGCCCGGACGCAGACGAGCTGGAC
CGGCTGACCGAGGCGCTCCGGCTTCCCTCTTTCGACGAGATGTGCGCGTCTTTGACCGAGAACTCTCGCTTGTGC
GGGTGGCCGGGCGCGACGCGCGACATCGTGTCGGGCTGGGTGATGCACCAGATACTGTATCCGCGGAAGCAGGGC
GACCCGCGCCCGTCGGCCCTGGTGGTCCATCCGGCCATATTCGAGCTCATCGGCCTGCCCAAGACGTATGACACG
CTGATTGAGGAGGCGACGAGGCGGCGGTGTCCGACGACGGGCAAGGACTTGACGGACCCCGTCATCTGCCTGTTC
TGCGGCGAGCTGCTCTGTAGTCAGAGCACTTGCTGTCAACAACCGGCCGTCATCAGCAATGAGCCGACCAGGATC
GGCGGCGCGCAGCGACACGTCCGCAGATGCCAGCGCAACATGGGTGTCTTCCTCAACATCCGCAAATGCACGACG
GTCTATCTATTTCGGCAGTCGGGGTCGTTTACGGCGGCGCCTTATATCGACAAGTACGGCGAGACGGACTTTCAG
CTGCGTCACGGACGACAGCTCTTTTTGAATCAGAGGAGATACGACACGATGATACGAAATACGGTTCTTAACCAC
GGGGTTCCGAACCTCATCAGCCGCAAGCTGGAGGCGGATATAAACAATGGCGGATGGGACACGCTGTAA
Gene >Ophcf2|04664
ATGGAGACGCCACCGTCCACACAGGAGCAGCAGCTCTGCCAGCTGCTGGCCGATCTGCCCTTGCGTTTCAACTAC
CGCTACACGGTAGACGCGTCGCGCGAGCTTCTCATCAACCTGTTCTGGTCGCTGGCGGGCGGCAACCATGACTAC
CTACGACTCCTCTTCCCCTCGGGCAAGCTGTGCGACAGCCTCAAGCTCGGCGATGCCCAGGGCGCCGTCGAAGGG
GCCGAATACACAGAAGGTGCTCGCGGGAAACGCTGTGGCCACATCTTCAGGCCCGGCGAGGCCTCGTACATGTGC
CGAACCTGTGGCATCGACGAGACGTGCTGTCTGTGCAGCAGATGCTTCGAAGCGACCGACCACACGGGTCACATT
GTCCGTATACAAATATCCGTTGGCAACAGCGGCTGTTGCGACTGCGGAGACGAAGAGGCCTGGCGGACGCCTCTG
CTCTGCACCATTCATTCCGACTTGGACAAAGGCCCGGACAAGGGCAAGCATCGGGAGGCTGCCGCCCTGCCCGAG
GATCTCGTGGCTAATCTCCAGATGACCATCGGGAGAGTCTTTGACTACATCTGCGACGTCGTCTCGTGTTCTCCC
GAGCAGCTGCGTCAGTCCAAGACCAAGGCGTCCATCTCCTATGACGAACAGTCGTCCCGCCTAGCTTCTAAATAC
TACGGCCCCAACGCCGACGCCTGCGGCGATTTCGCCCTCATACTCTGGAATGATGAAAAGCACACTGTCCAGGAA
GTGGAGGACCAGGTGGCCCGAGCCTGTCGAAAGACGGCCCGCGACGCCTCGAACAACGCCTGGGAGACGGATAAC
GTTGGGCGCAGCATACTGACATTCTCGACCGACATTGACGAGCTCCTGCAAATGGCCAGGATCATGGAGTCCATA
CGTGTTACCGTCACCATCCGCTCGGCCAGAGACACTTTTCGCGAGAGGATGTGTGGAACTCTGGTGGAATGGCTG
AGCGACATATCCGTCTGCTCCGTCGGTCACGACAGTCACATACTTAGGCAGACAGTTTGTGAGCAAATCATGCTG
CCGTGGCGGCGGGGAAGCCGTGCCTCCAACACTCTGGGCCTTATCGATGACGAGGAGGAGGATGAGCAGAGCATG
GCGCCGATACGCGGGCTGAACACGCGCTTCATCTTGGCAGTCACCGGAAACCCCGCCGGCCTGGAGATTGCCATC
GGGGCGGGCGACGACAGCGACGACAGCGACGACAACGGCGCCGGCAATGGCGGTGAGGACGAAGGCGGAGACGAT
GGTGCTGGGGACGATGCGGACATGGATGACGGCGACGCGGAGAACCGGTCCGGATCGAGCTCCGTCGCGGGCCGT
GGCGAGGATGAAGATGAGGATGTCATGATGGTAGACGCTAGAGGCGAAGTGGCCGACTTGGGAATGAACTGGAAC
CAAGCAGACCAGGCCCTGGAGGAGGATGAGGCAACCATGGCAGGCTATCCGCCACCGCCGCCACCGCCGCCGCCA
CCGCCGCCGCCGGCGCCAGGCCGTCGAGACCGGGACGGAACGCCGTCAGATTCGGACACGGCAGAGCCGCTCATC
GCACCGGCTATCTTCGCCAAGGCTAACGTCCACATCCCCAAGACACCTGGCAAGACGGAGAGGGCCACTCCCCGG
CCTGGTAGATATTGGGTCGAGACGCCGGCATTGTATACTCGACGCGACAATGTGCCGCCGGCCGAGAACGTCTTT
CAGCGTGTCCGCCTCGACTGGCTGCTTCTCTTTGATCTGCGCATGTGGAAGAAGGTCCGGAACGACCTGCGTGCG
CTCTACATATCCACCGTTGTGCAGATTCCAGAGTTCAAGCGCGTCCTGGCTCTGCGTTTCGCGAGCCTCTATACC
ATCCTCGCCCAGCTATACCTCGTCGGCGACCGTGAACCGGATCACTCCATCATCAACCTCTCTCTCCAGATGCTG
ACGGTTCCCTCCATAACGGCCGAGGTGGTCGAGCGAGGCAACTTCTTGAGCAGCCTGCTGGCCATTCTGTACACC
TTCCTGACGACCAGGCAGGTCGGCCATCCTTGGGACGTGTCCCCGGACGCCTTCTTGGCCTTTGACAGCGGCTCC
GTCACCAACCGGCGCATGTACCATTTCTATCAGGACCTCAAGTATCTCTTCAGCTCGACGCATGTGCGGGAACGG
ATCCGGTCCGAGCCTCGATACCTGATGCAATTCTTAGATCTGGTGAAGCTGCATCAGTGCATAGGCCCCAACGTA
CGGGCCGTGACAGAGCATGTCGAGTACGAGGCCGACACGTGGATCACGGCTTCGCTGGTGACTCGCCAGATCAAC
TCGCAGGCTCGAAACCTGGCCGAGGCCTTCCGAGACTGTCCGCCCGACGAAGTTCACTATCTGCAGCGGGCGATA
CGCTTCACTGCCAAGACGGTCATCCTCAACTCCGTCGGGGCGGAGCGCCAGAGGTTTAAGCAGGCAGAGATCAAG
GATGACGAGGTCAAGTTCAAGACGTTGAGTGATTTCGAATTCGAGGCCGACGACGCTTCCTACAACGTCGTGAGA
TTCGTGGTCGAGAAGGACCCCATCAGCTTCCACCACGCCCTGCACTACACCCTCTCTTGGCTCATCGAGTGCGGC
AGGTCGATACCCGCGTCGAGCATGCGGACCCTCCTGAGCTTCACCGCCCACGAGCTCAGGTCGAAGCCCAGGCTG
ATGGGCCGCTCCCAGCTTCCCAAGACGGAGCTCAGTGCGGAAGACTATCTTTTGGTCGCGTTCGACTTTCCCCTC
CGAGTCTGTGCCTGGCTGGCTCAGATCAAGGCCAATATGTGGGTGCGTAACGGCATCAGTCTGCGGCACCAGGCC
GGCACGTATCGCGGCGTCCAACAACGGGACGTCTGCCACCATCGAGACATCTTTCTTCTGCAGACGGCCATGGTC
GTGTGCGATCCGAGCCGGGTGCTGGCGTCCATCATCGACCGCTTCGGCATGGACGGCTGGGTCAAGGGGCTCTTC
GCGCTCAACTCGGAGGCCCAAGACGATAACCAGCATCTCGACGTGGTTGAGGACATGATTCACCTGCTCATAGTA
CTCCTCAGCGATCGCACCCCTCTGATTGCGCCCGAGGACGAGCCTAACTCGCGGACGCTCGCCATGCGCCGCGAC
CTCACTCACGTTCTGTGCTTCAAGCCCCTGTCCTTCAACGAGATCTGCAACAAGCTTCCCGAAAAGTACCAAGAA
CAGGAGGACTTTCATCGGTTTCTCGACGAAATGGCCACCTTCAAGCCGCCCGAGGGCGTCTCTGACGTGGGCACG
TTTGAACTGCGGCACGAGTTTATCGAGGACATCGACCCGTACATTGCGCATTACAACAAGAACCAGCGGGAAGAG
TCGGAGATGGCGTATCGGAAGAAGATGGCCAAGAAGACGGGAAAGACGGTGGATGAGATTGTCTACGAGCCCAAG
CATCGGCCCATACCGTCGGGCCTGTTTGAGAAGCTGGGCGACTTCACCGGCACCGGCGTCTTTGCCCAGATTATC
TTCTACTCGCTCCTGTATCCGCTCGTCGCTCACCGGCACACGCCGTCGGTGCCCTTGACCAGGCTGGAGACGTTT
CTCCAGGTGGTGCTGCACCTGATTCTCGTCGCCATTCTCGAGGACGGCACGTCGGAGGACGACGAGTCGGCGACG
AACACATCGAGCTCCTTCGTCTACAACGCGCTGACGAAACAGGCGCGCTGCAGATTCTTGCCCGACGCCAGCAAC
GCGAGGACCATTGTGTCGCTGCTCAACCTCCTCTCGACAAAGGAACAGTTCAAGTCGGCCCACCCCAAGGTCGCT
CTCGTGCTTAAGCGGCTAAAGCAGAAGCGACCGAGGGCACTGGAAGCAGCCTTTAACAATCTCGGCATCGCCGTC
GACCGCATCAACACGGCTTCGCCGGCCAATAGCTCAGCCGAGGAGGAGCGCGAGCGCAGGAAGAAGGCGGCGCTG
AGCCGCCAGGCCAGGGTCATGGCACAGTTCCAGCAGCAGCAGAACCGCTTCCTGGAGAACCAGGGCGCCATCGAC
TGGGGCTCCGACCTAGACGACGAGGAAGAGGTGCAGCAGACGGAAGATCGCAAGCACGACTGGAAGTATCCGACC
GGAACTTGCATCCTTTGCCAGGAGGACGCCGACGATCGCCATCTGTACGGCACCTTTGCCCTCTTGTGCGAGAGT
CGCATCGTGCGCCAGACCGACTTCCAAGACGCCGACCTGGTGAGGGAAGCGTCGCAGACGCCGTGCAGCCTCGAC
CGATCGGCGGATGATATTCGACCCTTTGGCATCGCGCGGGAGAACCGCAAAATGGTGGAGAAGCTGAACCACACA
GGAGAGGTGTTCCTGGCCGAGCGCCAGACCATCGGCAAGGGATATCCGGGCGCGCTGGCGAGGCCCGGGCCCGTG
GCGAGCGGGTGCGGACACATGATGCACTTTCACTGCTTCCAGATGTACTGCGATGCCACGAGACGCAGACACGAT
CACCAGATCGCCCGTCATCATCCGGAGGACACGAAGCGCAACGAGTTTGTGTGCCCGCTCTGCAAGGCGTTGGGC
AATGCCTTCTTGCCCATCGTCTGGAGGGGACTGGAGGAGTCGTATCCCGGCTATCTCCAACCCCAGGGCTCGTTT
GCCGACTTCCTGGGCAAGCACATGGGCCACTCGTACTGGCTCGGAGTGGGCAAGGCCAGGCAGACGGACGCACCG
GGCCTTCCAGAGCTGCACACTCCCAGCACGCCCGGGAGCCTGTTGGAGATGATGAGGAGACCCGGCTTGGCTGGC
ATAATGGAGTCTGGGGCATCGCCATCGAGGGACATATCCGCCGGCGCAAGCTCGTCGTCGTCGGGGCCGCCCGTC
CACAGCGAGATCGTCCAGGACCTGATGGCCGCGTACCGACGCCTGCGGGACACGATCCGCAAGAACAACCTCAGC
ACCAAGGAGGCGATCGGCGTCAAGTCGGAGCACGAAGAAGAATTGCACTTCAGCGACACGCTCGTTCTCGCCGTC
GGCTTCACCATATCGTCGGTAGAGATACAGCAGCGCGGGGTCGAGGCGCAGCTTGGCATGACGCTGCTGGACAAG
ATCCCTGATCAGGTCCTGACGCACCTGAGGGTCCTGTCGGAGACGGCGTCGTCCTACGCGACGGTCGGCGCCCAG
GTTTCGGCCTCCAAGAGCCGGATCGAGGGCGAGTTCCGGCGGGACAGCGACCGGCAGCACTGCCAGCTCTTCATC
GCGCGTTATCTGGGCACCAGCTCGCCCGAGTCGTCGCAGCCGACGGAAAGCTACACGCCGCTGCTGACCCTGGAC
CCGTTCGTGTTACTGGTCGAGTGCGCGTACGGGCTGGTACGGGCGCATAGGGCCGAGATCTCGCACCTGGTCAGG
CTGTGCTACCTGGCGGAGCTGGTCAAGGTGGTGTATCACATGGGCCGCAATATGCCCGAGGCTCTCTGGCTCGGC
GGGCTCAGGAACCGACGGGCGCAGACGCAGGACGCTGCCATCCACAACTTTGCCTGCTTCGCCCTCCAGGTGACC
GAGTGCGGCATAACGTGCCGGAACACCATGGCCATGGCCGCGACCGAGGAGGGCCCGAACAGGGGCTTTCAACAG
CCGGGCGTCGACTCGCCCGAGGGCTGGTACACGCTGGCCAAGAAGTACGCCCTGGTGTTTCTGCGCAAGACGCTG
CTGTTCCTGTACGTCCGGTACGGCGTCGATTTTGGCAGCCACATATCGCCGGGCCCGGACGCAGACGAGCTGGAC
CGGCTGACCGAGGCGCTCCGGCTTCCCTCTTTCGACGAGATGTGCGCGTCTTTGACCGAGAACTCTCGCTTGTGC
GGGTGGCCGGGCGCGACGCGCGACATCGTGTCGGGCTGGGTGATGCACCAGATACTGTATCCGCGGAAGCAGGGC
GACCCGCGCCCGTCGGCCCTGGTGGTCCATCCGGCCATATTCGAGCTCATCGGCCTGCCCAAGACGTATGACACG
CTGATTGAGGAGGCGACGAGGCGGCGGTGTCCGACGACGGGCAAGGACTTGACGGACCCCGTCATCTGCCTGTTC
TGCGGCGAGCTGCTCTGTAGTCAGAGCACTTGCTGTCAACAACCGGCCGTCATCAGCAATGAGCCGACCAGGATC
GGCGGCGCGCAGCGACACGTCCGCAGGTGAGAGACGAGCTGAGGTTGTTGGGAAGGGCGATGCAATGGAGTGCTG
ACGAGAGAGGATGATGATCTGCAGATGCCAGCGCAACATGGGTGTCTTCCTCAACATCCGCAAATGCACGACGGT
CTATCTATTTCGGCAGTCGGGGTCGTTTACGGCGGCGCCTTATATCGACAAGTACGGCGAGACGGACTTTCAGCT
GCGTCACGGACGACAGCTCTTTTTGAATCAGAGGAGATACGACACGATGATACGAAATACGGTTCTTAACCACGG
GGTTCCGAACCTCATCAGCCGCAAGCTGGAGGCGGATATAAACAATGGCGGATGGGACACGCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail