Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04644
Gene name
Locationscaffold_05:90167..91830
Strand-
Gene length (bp)1663
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 1.1E-11 337 380

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0005515 protein binding No
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5685 0.7811 0.0805 0.0377 0.1433 0.0003 0.0538 0.085 0.0287 0.0031

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4651
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1428
Ophiocordyceps australis map64 (Brazil) OphauB2|5454
Ophiocordyceps camponoti-floridani Ophcf2|04644 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|806
Ophiocordyceps kimflemingae Ophio5|8076
Ophiocordyceps subramaniannii Hirsu2|98

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04644
MEAQQQRPTPAKTAGLTNILNQDDQPSAHNAPLPQLRDSGFYSTADTSSSKHTSAASFSVNGLSPAASGYQSSSA
DKTPSPVAANMMPQALVSPSASNMSVASMVSPTSPVSLRFNRTTSLESQPPNGATLGESLAAGASIARRESVDSR
INQGLSDMRLGGSPYASNNHSTTSIHNALHSQRIPRPGFDALSMHRISNGYQPSADRNPEPKTVKTAPAITGPAT
GHIARAAEPTKGQAWAFPEEEISRVGPRYDDSRRSSITESVASSQFTTESRLPPGQRRLDDGPDHLRLAHHSDFP
PVHHHHSMQHKQLSDLQAEEGGGPTGSQPYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEI
LTKAIAEHQRMNEHIRLLQTHYNTALSEIDLLRREINSMRMESGHPQSTQQQPPPPPPPPPPPPPPPQAQQAQPG
PYPADAYSSASRTELPPLRSISSSIPSGPDSMTGVQYEPPRINGYRQERY*
Coding >Ophcf2|04644
ATGGAGGCCCAGCAGCAGCGGCCGACGCCCGCCAAGACTGCGGGCTTGACAAACATACTCAATCAGGACGATCAG
CCTTCGGCGCACAATGCCCCTCTCCCCCAGCTGCGCGATTCTGGCTTCTATTCGACGGCCGATACGTCGAGCAGC
AAACACACTTCTGCCGCCTCGTTCAGCGTCAACGGGCTCAGCCCGGCCGCTTCAGGCTATCAGTCGTCGTCGGCC
GACAAGACGCCGTCCCCCGTCGCCGCCAACATGATGCCTCAGGCCCTCGTCTCTCCCTCGGCCAGCAACATGAGC
GTCGCCTCCATGGTGTCGCCAACGAGCCCCGTCAGCCTCCGATTCAACCGAACCACGTCGCTCGAGTCGCAGCCC
CCCAATGGCGCCACTCTCGGAGAGAGCCTCGCCGCCGGCGCCTCCATCGCCAGGCGCGAGAGCGTCGACAGCCGC
ATCAATCAGGGCCTCAGCGATATGCGCCTCGGCGGCTCCCCCTACGCCAGCAACAACCACTCCACCACGTCGATC
CACAATGCGCTGCACTCGCAGCGCATCCCCCGTCCCGGCTTCGACGCCCTCTCCATGCACAGAATTTCAAATGGT
TATCAGCCGAGCGCGGATCGGAACCCGGAACCAAAGACGGTCAAGACGGCGCCGGCTATTACCGGCCCCGCCACC
GGACACATCGCCCGGGCCGCCGAGCCGACTAAGGGTCAGGCTTGGGCGTTTCCCGAGGAGGAGATATCCAGGGTG
GGGCCGCGCTACGACGACTCGAGACGGAGCAGCATCACCGAGTCCGTCGCCAGCAGCCAGTTCACCACCGAGTCC
CGCCTGCCGCCCGGCCAGCGGAGGCTCGACGACGGGCCGGATCATCTCCGTCTGGCTCACCACTCCGACTTTCCC
CCGGTTCACCATCACCACAGCATGCAACACAAGCAGCTCAGCGACCTGCAGGCCGAAGAGGGCGGAGGGCCCACG
GGCTCTCAGCCCTACAGCAGGACGCCCGAATTGAGGGTCAGTCACAAGCTGGCCGAGAGGAAGCGGCGCACCGAG
ATGAAGGAGCTCTTCGATCAGTTGCGCGATCTCATGCCTCAGGAGCGGGGGTCCAAGGCCTCCAAGTGGGAGATT
CTTACCAAAGCCATCGCGGAGCATCAAAGAATGAACGAGCACATTCGGCTGCTGCAGACGCACTACAACACGGCC
CTGTCCGAGATTGACCTCCTCCGCCGCGAGATCAACAGCATGAGGATGGAATCGGGGCACCCGCAGTCGACGCAA
CAACAGCCTCCGCCCCCACCGCCTCCTCCACCGCCTCCTCCTCCTCCTCCTCAGGCTCAACAGGCGCAGCCTGGA
CCTTACCCGGCCGACGCCTACTCCAGCGCCAGCCGGACGGAGCTGCCGCCGTTGCGGTCCATCAGCAGCAGCATA
CCCAGCGGGCCGGACTCGATGACGGGCGTCCAATACGAGCCGCCACGGATCAACGGATACCGGCAAGAGAGGTAC
TGA
Transcript >Ophcf2|04644
ATGGAGGCCCAGCAGCAGCGGCCGACGCCCGCCAAGACTGCGGGCTTGACAAACATACTCAATCAGGACGATCAG
CCTTCGGCGCACAATGCCCCTCTCCCCCAGCTGCGCGATTCTGGCTTCTATTCGACGGCCGATACGTCGAGCAGC
AAACACACTTCTGCCGCCTCGTTCAGCGTCAACGGGCTCAGCCCGGCCGCTTCAGGCTATCAGTCGTCGTCGGCC
GACAAGACGCCGTCCCCCGTCGCCGCCAACATGATGCCTCAGGCCCTCGTCTCTCCCTCGGCCAGCAACATGAGC
GTCGCCTCCATGGTGTCGCCAACGAGCCCCGTCAGCCTCCGATTCAACCGAACCACGTCGCTCGAGTCGCAGCCC
CCCAATGGCGCCACTCTCGGAGAGAGCCTCGCCGCCGGCGCCTCCATCGCCAGGCGCGAGAGCGTCGACAGCCGC
ATCAATCAGGGCCTCAGCGATATGCGCCTCGGCGGCTCCCCCTACGCCAGCAACAACCACTCCACCACGTCGATC
CACAATGCGCTGCACTCGCAGCGCATCCCCCGTCCCGGCTTCGACGCCCTCTCCATGCACAGAATTTCAAATGGT
TATCAGCCGAGCGCGGATCGGAACCCGGAACCAAAGACGGTCAAGACGGCGCCGGCTATTACCGGCCCCGCCACC
GGACACATCGCCCGGGCCGCCGAGCCGACTAAGGGTCAGGCTTGGGCGTTTCCCGAGGAGGAGATATCCAGGGTG
GGGCCGCGCTACGACGACTCGAGACGGAGCAGCATCACCGAGTCCGTCGCCAGCAGCCAGTTCACCACCGAGTCC
CGCCTGCCGCCCGGCCAGCGGAGGCTCGACGACGGGCCGGATCATCTCCGTCTGGCTCACCACTCCGACTTTCCC
CCGGTTCACCATCACCACAGCATGCAACACAAGCAGCTCAGCGACCTGCAGGCCGAAGAGGGCGGAGGGCCCACG
GGCTCTCAGCCCTACAGCAGGACGCCCGAATTGAGGGTCAGTCACAAGCTGGCCGAGAGGAAGCGGCGCACCGAG
ATGAAGGAGCTCTTCGATCAGTTGCGCGATCTCATGCCTCAGGAGCGGGGGTCCAAGGCCTCCAAGTGGGAGATT
CTTACCAAAGCCATCGCGGAGCATCAAAGAATGAACGAGCACATTCGGCTGCTGCAGACGCACTACAACACGGCC
CTGTCCGAGATTGACCTCCTCCGCCGCGAGATCAACAGCATGAGGATGGAATCGGGGCACCCGCAGTCGACGCAA
CAACAGCCTCCGCCCCCACCGCCTCCTCCACCGCCTCCTCCTCCTCCTCCTCAGGCTCAACAGGCGCAGCCTGGA
CCTTACCCGGCCGACGCCTACTCCAGCGCCAGCCGGACGGAGCTGCCGCCGTTGCGGTCCATCAGCAGCAGCATA
CCCAGCGGGCCGGACTCGATGACGGGCGTCCAATACGAGCCGCCACGGATCAACGGATACCGGCAAGAGAGGTAC
TGA
Gene >Ophcf2|04644
ATGGAGGCCCAGCAGCAGCGGCCGACGCCCGCCAAGACTGCGGGCTTGACAAACATACTCAATCAGGACGATCAG
CCTTCGGCGCACAATGCCCCTCTCCCCCAGCTGCGCGATTCTGGCTTCTATTCGACGGCCGATACGTCGAGCAGC
AAACGTAGGTGGCGGCCTGCTTCCTCTCTTCTCCCCCGCCTGCCGTTGCTCACGTCCGCAGACACTTCTGCCGCC
TCGTTCAGCGTCAACGGGCTCAGCCCGGCCGCTTCAGGCTATCAGTCGTCGTCGGCCGACAAGACGCCGTCCCCC
GTCGCCGCCAACATGATGCCTCAGGCCCTCGTCTCTCCCTCGGCCAGCAACATGAGCGTCGCCTCCATGGTGTCG
CCAACGAGCCCCGTCAGCCTCCGATTCAACCGAACCACGTCGCTCGAGTCGCAGCCCCCCAATGGCGCCACTCTC
GGAGAGAGCCTCGCCGCCGGCGCCTCCATCGCCAGGCGCGAGAGCGTCGACAGCCGCATCAATCAGGGCCTCAGC
GATATGCGCCTCGGCGGCTCCCCCTACGCCAGCAACAACCACTCCACCACGTCGATCCACAATGCGCTGCACTCG
CAGCGCATCCCCCGTCCCGGCTTCGACGCCCTCTCCATGCACAGAATTTCAAATGGTTATCAGCCGAGCGCGGAT
CGGAACCCGGAACCAAAGACGGTCAAGACGGCGCCGGCTATTACCGGCCCCGCCACCGGACACATCGCCCGGGCC
GCCGAGCCGACTAAGGGTCAGGCTTGGGCGTTTCCCGAGGAGGAGATATCCAGGGTGGGGCCGCGCTACGACGAC
TCGAGACGGAGCAGCATCACCGAGTCCGTCGCCAGCAGCCAGTTCACCACCGAGTCCCGCCTGCCGCCCGGCCAG
CGGAGGCTCGACGACGGGCCGGATCATCTCCGTCTGGCTCACCACTCCGACTTTCCCCCGGTTCACCATCACCAC
AGCATGCAACACAAGCAGCTCAGCGACCTGCAGGCCGAAGAGGGCGGAGGGCCCACGGGCTCTCAGCCCTACAGC
AGGACGCCCGAATTGAGGGTCAGTCACAAGCTGGCCGAGAGGAAGCGGCGCACCGAGATGAAGGAGCTCTTCGAT
CAGTTGCGCGATCTCATGCCTCAGGAGCGGGGGTCCAAGGCCTCCAAGTGGGAGATTCTTACCAAAGGTTAGATG
ACGATGATGATGATGATGATGATGATGATGATGCGGATGACGTTGTCTCGCGGCGCGCCCGAAGCTGACGTGCTT
TCTTTTTCCCTTACCGACAGCCATCGCGGAGCATCAAAGAATGAACGAGCACATTCGGCTGCTGCAGACGCACTA
CAACACGGCCCTGTCCGAGATTGACCTCCTCCGCCGCGAGATCAACAGCATGAGGATGGAATCGGGGCACCCGCA
GTCGACGCAACAACAGCCTCCGCCCCCACCGCCTCCTCCACCGCCTCCTCCTCCTCCTCCTCAGGCTCAACAGGC
GCAGCCTGGACCTTACCCGGCCGACGCCTACTCCAGCGCCAGCCGGACGGAGCTGCCGCCGTTGCGGTCCATCAG
CAGCAGCATACCCAGCGGGCCGGACTCGATGACGGGCGTCCAATACGAGCCGCCACGGATCAACGGATACCGGCA
AGAGAGGTACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail