Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04643
Gene name
Locationscaffold_05:87495..89033
Strand-
Gene length (bp)1538
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 1.5E-09 16 51

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0008270 zinc ion binding Yes
GO:0031323 regulation of cellular metabolic process No
GO:0050794 regulation of cellular process No
GO:0080090 regulation of primary metabolic process No
GO:0003700 DNA-binding transcription factor activity No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0043169 cation binding No
GO:0031326 regulation of cellular biosynthetic process No
GO:0005488 binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0051252 regulation of RNA metabolic process No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0065007 biological regulation No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0009889 regulation of biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.4268 0.8146 0.1204 0.0311 0.0875 0.052 0.0667 0.1107 0.0639 0.0057

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4621
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2004
Ophiocordyceps australis map64 (Brazil) OphauB2|5453
Ophiocordyceps camponoti-floridani Ophcf2|04643 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6132
Ophiocordyceps kimflemingae Ophio5|6712
Ophiocordyceps subramaniannii Hirsu2|97

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04643
MIDTSSAAGIAASRQKSCNACVRGKRRCDKRAPRCSRCVARGLDCVYYRPQPLTTTSSSEYGGSPDERDPSSESL
LDVSLADLLAVPEGGWTLDGLDGFVPPVRDVSVLRTSEQICVSLDALQVHDPRSRVGFIVGFLSGLGEQLRVRSA
LPFMHSRLWAATLPPPLLAAFSAASARGGRSVANRGWTARLVAEACRDVVRSGESLPLDDDDDDDDKDEDYEDEG
RERHLLARVQALTVANSIRVFDGDIGLAAAAERDMSVLVSWLGDLVGLRERLEGRAGGAGGRPCAHLPPESWESW
VFLESVRRTIITASAFMCIVHLLRSEQPAANMWIEKQNFTASRHLWEATSSVEFYRAWREKPAYWVENSAFGDVW
MYARPADLDEFTTVMLTPYVGVDAMEHFMETPTSEYNS*
Coding >Ophcf2|04643
ATGATCGATACATCCTCGGCAGCAGGCATCGCAGCGTCTCGCCAAAAGAGCTGCAACGCCTGCGTCCGCGGCAAG
CGAAGATGCGACAAGCGCGCGCCCCGATGCTCACGCTGCGTAGCGCGCGGCCTCGACTGCGTCTACTACAGGCCT
CAGCCTCTCACGACGACCTCATCGTCCGAATACGGGGGAAGTCCAGACGAGCGGGATCCGAGTTCGGAGTCGCTG
CTTGACGTTTCGCTGGCGGACTTGCTGGCTGTTCCAGAGGGAGGGTGGACGCTTGACGGGCTGGATGGCTTCGTG
CCGCCCGTGAGGGATGTTTCTGTGTTGAGGACGAGTGAGCAGATTTGTGTTTCGCTTGATGCTTTGCAGGTTCAT
GATCCGCGGTCGAGGGTCGGATTCATTGTCGGATTCCTTTCTGGGTTGGGGGAGCAGCTTCGGGTGAGGAGCGCT
TTGCCGTTTATGCATTCGAGGCTTTGGGCTGCGACGTTGCCTCCTCCTCTGCTGGCAGCCTTCTCAGCCGCCAGT
GCTCGCGGGGGAAGATCGGTCGCGAACAGAGGCTGGACTGCGAGGTTAGTTGCCGAGGCGTGTCGCGACGTGGTT
CGCTCGGGTGAATCCTTACCCCTTGACGACGACGACGACGACGACGACAAGGACGAAGACTACGAGGACGAGGGT
CGCGAGCGGCACCTCCTGGCGCGCGTGCAGGCTCTGACGGTGGCGAACTCGATCCGCGTCTTTGACGGCGATATC
GGGCTTGCGGCTGCGGCGGAGAGGGATATGTCCGTCTTGGTATCTTGGTTGGGGGACCTTGTCGGCTTGAGGGAG
AGGCTCGAGGGGAGGGCTGGGGGGGCGGGGGGGAGACCTTGTGCGCATCTTCCGCCTGAGAGTTGGGAGAGTTGG
GTGTTTTTGGAGAGCGTGAGGAGGACTATCATCACGGCTTCGGCGTTTATGTGCATCGTTCACCTCCTACGCTCA
GAGCAGCCCGCGGCGAACATGTGGATCGAGAAGCAAAACTTCACAGCCTCGCGCCACCTATGGGAAGCAACCAGC
TCGGTGGAATTCTACCGCGCCTGGCGGGAGAAGCCGGCCTACTGGGTTGAGAACTCTGCCTTTGGCGACGTGTGG
ATGTATGCGAGGCCGGCCGACTTGGATGAGTTTACGACGGTCATGCTTACGCCGTATGTTGGTGTTGATGCTATG
GAGCATTTTATGGAGACTCCTACGTCAGAGTACAACTCCTGA
Transcript >Ophcf2|04643
ATGATCGATACATCCTCGGCAGCAGGCATCGCAGCGTCTCGCCAAAAGAGCTGCAACGCCTGCGTCCGCGGCAAG
CGAAGATGCGACAAGCGCGCGCCCCGATGCTCACGCTGCGTAGCGCGCGGCCTCGACTGCGTCTACTACAGGCCT
CAGCCTCTCACGACGACCTCATCGTCCGAATACGGGGGAAGTCCAGACGAGCGGGATCCGAGTTCGGAGTCGCTG
CTTGACGTTTCGCTGGCGGACTTGCTGGCTGTTCCAGAGGGAGGGTGGACGCTTGACGGGCTGGATGGCTTCGTG
CCGCCCGTGAGGGATGTTTCTGTGTTGAGGACGAGTGAGCAGATTTGTGTTTCGCTTGATGCTTTGCAGGTTCAT
GATCCGCGGTCGAGGGTCGGATTCATTGTCGGATTCCTTTCTGGGTTGGGGGAGCAGCTTCGGGTGAGGAGCGCT
TTGCCGTTTATGCATTCGAGGCTTTGGGCTGCGACGTTGCCTCCTCCTCTGCTGGCAGCCTTCTCAGCCGCCAGT
GCTCGCGGGGGAAGATCGGTCGCGAACAGAGGCTGGACTGCGAGGTTAGTTGCCGAGGCGTGTCGCGACGTGGTT
CGCTCGGGTGAATCCTTACCCCTTGACGACGACGACGACGACGACGACAAGGACGAAGACTACGAGGACGAGGGT
CGCGAGCGGCACCTCCTGGCGCGCGTGCAGGCTCTGACGGTGGCGAACTCGATCCGCGTCTTTGACGGCGATATC
GGGCTTGCGGCTGCGGCGGAGAGGGATATGTCCGTCTTGGTATCTTGGTTGGGGGACCTTGTCGGCTTGAGGGAG
AGGCTCGAGGGGAGGGCTGGGGGGGCGGGGGGGAGACCTTGTGCGCATCTTCCGCCTGAGAGTTGGGAGAGTTGG
GTGTTTTTGGAGAGCGTGAGGAGGACTATCATCACGGCTTCGGCGTTTATGTGCATCGTTCACCTCCTACGCTCA
GAGCAGCCCGCGGCGAACATGTGGATCGAGAAGCAAAACTTCACAGCCTCGCGCCACCTATGGGAAGCAACCAGC
TCGGTGGAATTCTACCGCGCCTGGCGGGAGAAGCCGGCCTACTGGGTTGAGAACTCTGCCTTTGGCGACGTGTGG
ATGTATGCGAGGCCGGCCGACTTGGATGAGTTTACGACGGTCATGCTTACGCCGTATGTTGGTGTTGATGCTATG
GAGCATTTTATGGAGACTCCTACGTCAGAGTACAACTCCTGA
Gene >Ophcf2|04643
ATGATCGATACATCCTCGGCAGCAGGCATCGCAGCGTCTCGCCAAAAGAGCTGCAACGCCTGCGTCCGCGGCAAG
CGAAGATGCGACAAGCGCGCGCCCCGATGCTCACGCTGCGTAGCGCGCGGCCTCGACTGCGTCTACTACAGGCCT
CAGCCTCTCACGACGACCTCATCGTCCGAATACGGGGGAAGTCCAGACGAGCGGGATCCGAGTTCGGAGTCGCTG
CTTGACGTTTCGCTGGCGGACTTGCTGGCTGTTCCAGAGGGAGGGTGGACGCTTGACGGGCTGGATGGCTTCGTG
CCGCCCGTGAGGGATGTTTCTGTGTTGAGGACGAGTGAGCAGATTTGTGTTTCGCTTGATGCTTTGCAGGTTCAT
GATCCGCGGTCGAGGGTCGGATTCATTGTCGGATTCCTTTCTGGGTTGGGGGAGCAGCTTCGGGTGAGGAGCGCT
TTGCCGTTTATGCATTCGAGGCTTTGGGCTGCGACGTTGCCTCCTCCTCTGCTGGCAGCCTTCTCAGCCGCCAGT
GCTCGCGGGGGAAGATCGGTCGCGAACAGAGGCTGGACTGCGAGGTTAGTTGCCGAGGCGTGTCGCGACGTGGTT
CGCTCGGGTGAATCCTTACCCCTTGACGACGACGACGACGACGACGACAAGGACGAAGACTACGAGGACGAGGGT
CGCGAGCGGCACCTCCTGGCGCGCGTGCAGGCTCTGACGGTGGCGAACTCGATCCGCGTCTTTGACGGCGATATC
GGGCTTGCGGCTGCGGCGGAGAGGGATATGTCCGTCTTGGTATCTTGGTTGGGGGACCTTGTCGGCTTGAGGGAG
AGGCTCGAGGGGAGGGCTGGGGGGGCGGGGGGGAGACCTTGTGCGCATCTTCCGCCTGAGAGTTGGGAGGTTTGT
GGTTCCCTTTGTGGTTTTTGCGCTTGTGCTGATGAATGATGGTGGTGGTGGTAGAGTTGGGTGTTTTTGGAGAGC
GTGAGGAGGACTATCATCACGGCTTCGGCGTTTATGTGCATCGTTCACCTCCTACGCTCAGAGCAGCGTACGTCG
TCGTATCCATCCCCCATGCCCTTCCCCCCCCCAAACTACTCAACAGATCTGACGATACCCAGCCGCGGCGAACAT
GTGGATCGAGAAGCAAAACTTCACAGCCTCGCGCCACCTATGGGAAGCAACCAGCTCGGTGGAATTCTACCGCGC
CTGGCGGGAGAAGCCGGCCTACTGGGTTGAGAACTCTGCCTTTGGCGACGTGTGGATGTATGCGAGGCCGGCCGA
CTTGGATGAGTTTACGACGGTCATGCTTACGCCGTGAGTCTCTCTGTCGGTACTGTGGCTGGGTGTCTTGCTGAT
GGTTGTGAGGTTTAGGTATGTTGGTGTTGATGCTATGGAGCATTTTATGGAGGTTGGGGGGGGTTGTGAAGGGGG
TTGTGAAGGGGCCTGCGCATGGGAGGTGACTATGTATATGGCTATGGAGGCTCTTTACTTGCTGTCGTGATTGGT
TTTCTGGAAAGACTCCTACGTCAGAGTACAACTCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail