Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04636
Gene name
Locationscaffold_05:72455..74824
Strand-
Gene length (bp)2369
Transcript length (bp)1893
Coding sequence length (bp)1893
Protein length (aa) 631

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00929 RNase_T Exonuclease 1.1E-07 304 452

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4275 0.7371 0.0786 0.012 0.1354 0.0102 0.1721 0.0194 0.0902 0.005

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2193
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7904
Ophiocordyceps australis map64 (Brazil) OphauB2|5446
Ophiocordyceps camponoti-floridani Ophcf2|04636 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7411
Ophiocordyceps kimflemingae Ophio5|6718
Ophiocordyceps subramaniannii Hirsu2|2732

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04636
MIIDQLLHLALARHYNLLARSRKDQEDADLSPLMSDGSLKRTNPHDEDDEAGGEWQVVTRPKKKPKKVPQSGRNY
PAFTFSSNKSRLTSKANLNQLRDLILYILADGPAPQWITVSHRPQFRKLVVIMIPGLEEAMFEEGVDLSTFADAG
NDKSVTDLDDCRPRPLIKDKLDAALQPLADMFAQMWPMRTPGDDRHARMHSPITSMLTAPAPKEKTSKQVHLGLE
PQGWQNERTRITEFLAATEELEDNNFMLHPALLPAGERRDAFVAPEGWVTTKLGSLDEGDVPEDEIESGSVTAGR
KVLALDCEMCLTGENEFALTRISIVDWAGDVVMDELVKPEKPIVDYVTRFSGITEEMLLPVTTTLADIQKRLLDL
MDARTILVGHSLESDTKALRLAHPFIVDTSILYPHPRGSPLKSSLKHLAQRFLSREIQKGGADGHNSVEDARTCL
DLVKQKCERGPKWGIPDNKGENLFRRLARAGTTYKVQGGDSARGGVETGKTSAAVDWGEPSRGAGAGATFQLGCR
NDDDVTDAIIRAVHGDADGKEIRAGGVDFIWARMRELEVQLGCGSGDPREMSRLQRQHARHRKEVNAQGTDDEGE
LSVKWTDEEQEALKRAVQVARSGIAFLGVK*
Coding >Ophcf2|04636
ATGATTATCGATCAGCTGCTTCACCTTGCTCTTGCTCGACACTATAATCTCCTAGCTCGCAGTAGAAAAGATCAA
GAAGACGCCGACTTGTCGCCCCTCATGAGCGACGGAAGCCTCAAGCGTACCAACCCGCATGATGAGGACGACGAG
GCCGGCGGCGAGTGGCAGGTCGTCACGCGGCCCAAGAAGAAGCCCAAAAAGGTCCCTCAATCGGGGAGAAACTAT
CCCGCCTTTACGTTTTCGTCCAACAAGTCTCGCCTGACATCAAAGGCCAACCTCAACCAACTACGCGATCTTATC
CTGTACATCCTCGCCGACGGGCCTGCGCCGCAGTGGATCACCGTCTCCCACCGGCCGCAATTCCGGAAGCTGGTC
GTCATCATGATTCCAGGTCTCGAGGAAGCCATGTTTGAAGAGGGCGTCGACCTGTCCACCTTTGCTGATGCGGGC
AACGACAAGTCCGTCACAGACTTGGATGACTGCCGCCCTCGCCCTCTCATCAAGGACAAACTCGATGCAGCTCTC
CAACCGCTGGCAGACATGTTCGCCCAAATGTGGCCCATGAGGACGCCAGGCGACGACAGGCACGCAAGGATGCAT
TCGCCCATCACCTCGATGCTCACAGCGCCCGCGCCCAAGGAGAAGACGTCGAAGCAAGTGCATCTAGGACTAGAG
CCGCAGGGCTGGCAGAACGAGCGAACGCGCATCACCGAGTTTCTCGCCGCCACCGAGGAGCTAGAAGATAACAAC
TTCATGTTACACCCTGCTCTCCTTCCCGCCGGCGAGCGACGGGATGCCTTTGTGGCGCCCGAAGGCTGGGTGACG
ACCAAGTTGGGGTCTCTGGACGAGGGCGACGTGCCCGAAGACGAGATTGAGAGCGGCAGCGTCACGGCAGGCCGA
AAGGTGCTGGCCCTGGATTGCGAGATGTGCTTGACGGGCGAAAACGAGTTCGCCCTGACGCGCATCAGCATCGTC
GACTGGGCAGGTGACGTGGTGATGGACGAGCTGGTCAAGCCCGAGAAGCCCATCGTTGACTACGTCACCCGCTTC
TCCGGCATCACAGAGGAGATGCTGTTGCCCGTGACGACGACGCTGGCCGATATCCAGAAGCGGCTCCTCGACCTG
ATGGACGCTCGCACCATCCTCGTCGGCCACTCGCTAGAATCAGACACCAAGGCTCTTCGTCTAGCTCACCCCTTC
ATCGTCGACACGTCGATACTATACCCTCACCCCCGAGGCTCACCCCTCAAGTCGTCTCTCAAGCACCTAGCCCAG
CGATTCCTATCCCGCGAGATCCAAAAGGGCGGCGCCGACGGCCACAACAGCGTCGAAGACGCAAGGACCTGTCTC
GATCTCGTCAAGCAAAAGTGCGAACGGGGTCCCAAATGGGGCATCCCGGACAACAAGGGCGAGAACCTCTTCCGC
CGCCTGGCCCGAGCAGGAACGACGTACAAGGTCCAGGGCGGCGACTCGGCCCGCGGAGGCGTCGAGACGGGAAAG
ACGAGCGCCGCCGTCGACTGGGGCGAGCCATCTCGCGGTGCGGGAGCGGGCGCTACGTTTCAACTCGGCTGCCGT
AACGACGACGACGTCACCGACGCCATCATCCGCGCCGTCCACGGCGATGCAGACGGTAAGGAGATTCGAGCCGGC
GGCGTCGACTTCATCTGGGCACGCATGCGCGAACTCGAAGTTCAACTGGGCTGCGGCTCGGGCGACCCGCGCGAG
ATGTCCCGACTGCAGCGACAGCACGCCCGCCATCGCAAGGAGGTCAACGCCCAGGGGACGGATGACGAGGGGGAG
CTTTCGGTCAAGTGGACGGATGAGGAGCAGGAGGCCTTGAAGAGGGCTGTGCAGGTTGCGCGCTCTGGGATTGCG
TTTTTGGGCGTCAAGTGA
Transcript >Ophcf2|04636
ATGATTATCGATCAGCTGCTTCACCTTGCTCTTGCTCGACACTATAATCTCCTAGCTCGCAGTAGAAAAGATCAA
GAAGACGCCGACTTGTCGCCCCTCATGAGCGACGGAAGCCTCAAGCGTACCAACCCGCATGATGAGGACGACGAG
GCCGGCGGCGAGTGGCAGGTCGTCACGCGGCCCAAGAAGAAGCCCAAAAAGGTCCCTCAATCGGGGAGAAACTAT
CCCGCCTTTACGTTTTCGTCCAACAAGTCTCGCCTGACATCAAAGGCCAACCTCAACCAACTACGCGATCTTATC
CTGTACATCCTCGCCGACGGGCCTGCGCCGCAGTGGATCACCGTCTCCCACCGGCCGCAATTCCGGAAGCTGGTC
GTCATCATGATTCCAGGTCTCGAGGAAGCCATGTTTGAAGAGGGCGTCGACCTGTCCACCTTTGCTGATGCGGGC
AACGACAAGTCCGTCACAGACTTGGATGACTGCCGCCCTCGCCCTCTCATCAAGGACAAACTCGATGCAGCTCTC
CAACCGCTGGCAGACATGTTCGCCCAAATGTGGCCCATGAGGACGCCAGGCGACGACAGGCACGCAAGGATGCAT
TCGCCCATCACCTCGATGCTCACAGCGCCCGCGCCCAAGGAGAAGACGTCGAAGCAAGTGCATCTAGGACTAGAG
CCGCAGGGCTGGCAGAACGAGCGAACGCGCATCACCGAGTTTCTCGCCGCCACCGAGGAGCTAGAAGATAACAAC
TTCATGTTACACCCTGCTCTCCTTCCCGCCGGCGAGCGACGGGATGCCTTTGTGGCGCCCGAAGGCTGGGTGACG
ACCAAGTTGGGGTCTCTGGACGAGGGCGACGTGCCCGAAGACGAGATTGAGAGCGGCAGCGTCACGGCAGGCCGA
AAGGTGCTGGCCCTGGATTGCGAGATGTGCTTGACGGGCGAAAACGAGTTCGCCCTGACGCGCATCAGCATCGTC
GACTGGGCAGGTGACGTGGTGATGGACGAGCTGGTCAAGCCCGAGAAGCCCATCGTTGACTACGTCACCCGCTTC
TCCGGCATCACAGAGGAGATGCTGTTGCCCGTGACGACGACGCTGGCCGATATCCAGAAGCGGCTCCTCGACCTG
ATGGACGCTCGCACCATCCTCGTCGGCCACTCGCTAGAATCAGACACCAAGGCTCTTCGTCTAGCTCACCCCTTC
ATCGTCGACACGTCGATACTATACCCTCACCCCCGAGGCTCACCCCTCAAGTCGTCTCTCAAGCACCTAGCCCAG
CGATTCCTATCCCGCGAGATCCAAAAGGGCGGCGCCGACGGCCACAACAGCGTCGAAGACGCAAGGACCTGTCTC
GATCTCGTCAAGCAAAAGTGCGAACGGGGTCCCAAATGGGGCATCCCGGACAACAAGGGCGAGAACCTCTTCCGC
CGCCTGGCCCGAGCAGGAACGACGTACAAGGTCCAGGGCGGCGACTCGGCCCGCGGAGGCGTCGAGACGGGAAAG
ACGAGCGCCGCCGTCGACTGGGGCGAGCCATCTCGCGGTGCGGGAGCGGGCGCTACGTTTCAACTCGGCTGCCGT
AACGACGACGACGTCACCGACGCCATCATCCGCGCCGTCCACGGCGATGCAGACGGTAAGGAGATTCGAGCCGGC
GGCGTCGACTTCATCTGGGCACGCATGCGCGAACTCGAAGTTCAACTGGGCTGCGGCTCGGGCGACCCGCGCGAG
ATGTCCCGACTGCAGCGACAGCACGCCCGCCATCGCAAGGAGGTCAACGCCCAGGGGACGGATGACGAGGGGGAG
CTTTCGGTCAAGTGGACGGATGAGGAGCAGGAGGCCTTGAAGAGGGCTGTGCAGGTTGCGCGCTCTGGGATTGCG
TTTTTGGGCGTCAAGTGA
Gene >Ophcf2|04636
ATGATTATGTCAGCAGACGAGCTCCAGCTGATGCACGTGATCAAACCAAAAGACCAAGCAAGCTTGATTGGCTAG
AAGTTTAGAACCATTCCTATCTTATCGTAACAACCACAAACGTTGAGTTTTCACGCGTCAACGTCCCACTACGCG
ACATTTGGGGTCTGAGTCCAGCATCCTTCCAGCGATCAGCTGCTTCACCTTGCTCTTGCTCGACACTATAATCTC
CTGTAAGCTTTCAGGTGCTACGATGATGGGCTGCATCCTCTCGTCGCGATGCGCCCGCGCTGAACCTGTCTCCCT
TGGCGACAGAGCTCGCAGTAGAGTTCGTCTCCCAAGACACCCTCAGGTCCCCCGGAGCTCGCGGAAGCAGATGGA
TCTATCGTAATGGAGCAGAAAGATCAAGAAGACGCCGACTTGTCGCCCCTCATGAGCGACGGAAGCCTCAAGCGT
ACCAACCCGCATGATGAGGACGACGAGGCCGGCGGCGAGTGGCAGGTCGTCACGCGGCCCAAGAAGAAGCCCAAA
AAGGTCCCTCAATCGGGGAGAAACTATCCCGCCTTTACGTTTTCGTCCAACAAGTCTCGCCTGACATCAAAGGCC
AACCTCAACCAACTACGCGATCTTATCCTGTACATCCTCGCCGACGGGCCTGCGCCGCAGTGGATCACCGTCTCC
CACCGGCCGCAATTCCGGAAGCTGGTCGTCATCATGATTCCAGGTCTCGAGGAAGCCATGTTTGAAGAGGGCGTC
GACCTGTCCACCTTTGCTGATGCGGGCAACGACAAGTCCGTCACAGACTTGGATGACTGCCGCCCTCGCCCTCTC
ATCAAGGACAAACTCGATGCAGCTCTCCAACCGCTGGCAGACATGTTCGCCCAAATGTGGCCCATGAGGACGCCA
GGCGACGACAGGCACGCAAGGATGCATTCGCCCATCACCTCGATGCTCACAGCGCCCGCGCCCAAGGAGAAGACG
TCGAAGCAAGTGCATCTAGGACTAGAGCCGCAGGGCTGGCAGAACGAGCGAACGCGCATCACCGAGTTTCTCGCC
GCCACCGAGGAGCTAGAAGATAACAACTTCATGTTACACCCTGCTCTCCTTCCCGCCGGCGAGCGACGGGATGCC
TTTGTGGCGCCCGAAGGCTGGGTGACGACCAAGTTGGGGTCTCTGGACGAGGGCGACGTGCCCGAAGACGAGATT
GAGAGCGGCAGCGTCACGGCAGGCCGAAAGGTGCTGGCCCTGGATTGCGAGATGTGCTTGACGGGCGAAAACGAG
TTCGCCCTGACGCGCATCAGCATCGTCGACTGGGCAGGTGACGTGGTGATGGACGAGCTGGTCAAGCCCGAGAAG
CCCATCGTTGACTACGTCACCCGCTTCTCCGGCATCACAGAGGAGATGCTGTTGCCCGTGACGACGACGCTGGCC
GATATCCAGAAGCGGCTCCTCGACCTGATGGACGCTCGCACCATCCTCGTCGGCCACTCGCTAGAATCAGACACC
AAGGCTCTTCGTCTAGCTCACCCCTTCATCGTCGACACGTCGATACTATACCCTCACCCCCGAGGCTCACCCCTC
AAGTCGTCTCTCAAGCACCTAGCCCAGCGATTCCTATCCCGCGAGATCCAAAAGGGCGGCGCCGACGGCCACAAC
AGCGTCGAAGACGCAAGGACCTGTCTCGATCTCGTCAAGCAAAAGTGCGAACGGGGTCCCAAATGGGGCATCCCG
GACAACAAGGGCGAGAACCTCTTCCGCCGCCTGGCCCGAGCAGGAACGACGTACAAGGTCCAGGGCGGCGACTCG
GCCCGCGGAGGCGTCGAGACGGGAAAGACGAGCGCCGCCGTCGACTGGGGCGAGCCATCTCGCGGTGCGGGAGCG
GGCGCTACGTTTCAACTCGGCTGCCGTAACGACGACGACGTCACCGACGCCATCATCCGCGCCGTCCACGGCGAT
GCAGACGGTAAGGAGATTCGAGCCGGCGGCGTCGACTTCATCTGGGCACGCATGCGCGAACTCGAAGTTCAACTG
GGCTGGTGCAACGACGGAACAGCAAGCGCAGCACCCATCAACACCAACGACTCCAACCCACCGCCCCCCTCCAAC
ACACCCTCACCGCCCTAACAACCCGCCTCGCCCGCATCCACGCCTCCCTGCCCCCCTGCACGGGCCTCATCCTCC
TCAGCGGCTCGGGCGACCCGCGCGAGATGTCCCGACTGCAGCGACAGCACGCCCGCCATCGCAAGGAGGTCAACG
CCCAGGGGACGGATGACGAGGGGGAGCTTTCGGTCAAGTGGACGGATGAGGAGCAGGAGGCCTTGAAGAGGGCTG
TGCAGGTTGCGCGCTCTGGGATTGCGTTTTTGGGCGTCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail