Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04635
Gene name
Locationscaffold_05:68128..71711
Strand+
Gene length (bp)3583
Transcript length (bp)3513
Coding sequence length (bp)3513
Protein length (aa) 1171

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 4.0E-36 283 650
PF14558 TRP_N ML-like domain 2.0E-20 91 271

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22
2 279 301 22
3 409 431 22
4 461 483 22
5 490 512 22
6 532 554 22
7 567 589 22
8 604 626 22
9 631 653 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04635
MARDGVLRGMRRREGTTTIKTTTIKTTTIKTKTKTTIDDVPRRHRCPFSSRRHNLPERRSARARPASSLLVIALT
LLLLLLLSASPASAARVPVASCLSSAPSQLQWRPLFADARFSGADNNYRLELVVWGNVSGSLDQAASLPPAGDSH
WTRPQETEGKIADSADKPDVESRKATTLIRKVNVLTYEVWADEPVSFCKKGLVNGTCPLGPVFDDGALTSPRGLL
PSVNLSHDFFSPYSFASFAPTIRIIYGDAKATDVGCITAVVTPDLASVAWLPRFLPLVILLISGLAVVLAAVFSP
WGSTSIVHWSSNYGRDADLLRLVTPGFGDCLQYIQFVVLTGALSLSYPGYYQPVVAQAAWSALMFNQSVVTGALS
WQSVVDGIYVTNSSDGHGLQQLGQLAGMARSADVWPGFMVCLGVILVGLFVAIQTGFLARWLWRRLYHIPEEDLR
AKNVPFTVGNLVRTVFNYMLVPIVALSCFQLVVARSSPAFTVALAVLTLVLLLVSAAWMLALVIRTRPKSVLFDD
LPTLLRIGPLYNTYSDQVAAFALIPVVLNLMRGIAIGAVQPSGVAQVVLLAICEVIQVFTLHAFRPFPAPTSMNA
YHTVFSLLRAVTLLLMVAFVPSLGVAEGRKCWIGYAILLIHAAVLVLGFFLSALKTMVEVLARLLGAGGDDVVGL
RRGGLSKIFGMRQLSRRETHRPGISRASHMSTAAILEMEDGSRAAAGSRMRSASTASLSQHLSHNQNLHHRQRSS
SALDSIDLYAGGGSRNADHSVSGVSYAPGETAFSFLASPRQAVSPTAAVEAADPYYRPPRRRRDTLSAGEAAYTD
APRAGEVEPKRPIQGPGPGSGPGLSGEVGLELPEEVARGATTTQLPLNVVTMDFPPNRPDYSTREVDFYYGVRGP
ALNSVGPGRKLGTGPADPTGPVATATGWFRNMFKGKKTKEKGKGFEVVRSSRMPPASFGDETPPEGIPVAMGVLR
NGPIDSDDDSLDGRKPRRRRPDHLLTDAGDAQSSDTSGPNSPVEEGAGGDGDDGTGRLISPLEDDVVDDDEDGDG
DEKEDEGFDLPVIPRKSSKRNSGSMDRSRHPILTLPAIDSSDTETQHQQQQRHQQPRLCPLSLQPPQAPCPPHPS
PPTRSADRPASFGVVRQHGISRVDPGEAVDLMGRRAEVIDGGEEF*
Coding >Ophcf2|04635
ATGGCTCGGGACGGGGTTCTCAGAGGGATGCGTCGACGCGAGGGGACGACGACGATCAAGACGACGACGATCAAG
ACGACGACGATCAAGACGAAGACGAAGACGACGATAGACGACGTCCCCAGACGCCACCGCTGTCCCTTCTCATCG
CGACGCCACAACCTCCCTGAAAGGCGCTCGGCTCGCGCCCGCCCCGCCAGCTCACTCCTCGTCATCGCCCTCACC
CTCCTCCTCCTCCTCCTCCTCTCAGCCTCTCCCGCATCAGCAGCACGCGTCCCCGTGGCCTCGTGCTTGAGCTCG
GCTCCCTCCCAGCTACAATGGCGACCGCTATTCGCCGACGCCCGCTTCAGCGGCGCCGACAACAACTACCGGCTC
GAGCTGGTGGTTTGGGGCAACGTCTCGGGGTCGCTCGACCAGGCGGCGTCTTTGCCTCCTGCGGGGGATTCGCAT
TGGACGAGGCCCCAAGAAACGGAGGGCAAGATTGCTGATTCGGCGGATAAGCCTGACGTGGAGAGTCGGAAGGCG
ACGACGTTGATTCGCAAGGTTAATGTATTGACGTATGAGGTTTGGGCTGATGAGCCTGTGAGCTTTTGCAAGAAG
GGGCTCGTCAATGGGACGTGTCCGTTGGGGCCGGTCTTTGACGATGGGGCCCTCACCTCTCCTCGCGGCCTCCTC
CCCTCGGTCAACCTCAGTCACGACTTCTTCTCTCCTTACTCCTTCGCCTCCTTCGCCCCGACGATCCGCATCATC
TACGGCGACGCAAAGGCCACCGATGTCGGCTGCATTACAGCCGTCGTCACCCCGGACCTGGCCTCGGTAGCCTGG
CTGCCGCGTTTCCTACCGCTCGTCATCCTCCTCATCTCGGGTCTGGCCGTCGTCTTGGCCGCCGTCTTCAGCCCC
TGGGGCTCAACCAGTATAGTCCACTGGTCTTCCAACTACGGCCGAGACGCCGACCTGCTACGCCTCGTCACCCCC
GGCTTCGGCGATTGCCTGCAGTACATCCAGTTCGTCGTCCTCACTGGCGCCCTCTCCCTCAGCTACCCGGGCTAC
TACCAGCCCGTCGTCGCCCAGGCCGCCTGGTCGGCTCTCATGTTCAACCAGAGCGTCGTCACCGGCGCGCTCTCG
TGGCAGAGCGTCGTCGACGGCATCTACGTCACAAACAGCTCCGACGGCCATGGCCTGCAGCAGCTCGGCCAGCTC
GCCGGCATGGCCCGCAGCGCCGACGTCTGGCCGGGGTTCATGGTCTGCCTGGGAGTCATCCTCGTCGGCCTCTTC
GTCGCGATCCAGACCGGATTCCTTGCCCGCTGGCTTTGGAGGAGACTCTACCACATCCCCGAGGAGGACCTGCGG
GCCAAGAACGTGCCCTTTACCGTCGGTAACCTCGTCCGCACCGTCTTCAACTACATGCTCGTCCCCATCGTTGCC
CTCTCCTGCTTCCAGCTCGTCGTGGCCCGCTCGTCTCCCGCCTTTACCGTCGCCCTCGCCGTTCTGACGCTCGTC
CTGCTCCTCGTCTCGGCCGCCTGGATGCTGGCCCTCGTCATCCGCACCCGGCCCAAGTCGGTCCTCTTCGACGAC
CTGCCCACGCTCCTCCGCATCGGGCCCCTCTACAACACCTACTCGGATCAGGTGGCCGCCTTTGCCCTCATCCCC
GTCGTCCTCAACCTGATGCGCGGCATCGCCATCGGCGCCGTCCAGCCCAGCGGCGTCGCTCAGGTCGTCCTGCTC
GCCATCTGCGAGGTCATCCAGGTCTTTACCCTCCACGCCTTCCGTCCCTTTCCCGCGCCCACGTCCATGAACGCC
TACCACACCGTCTTCTCCCTCCTGAGGGCCGTCACCCTGCTGCTGATGGTGGCCTTTGTCCCCAGCCTTGGCGTC
GCCGAGGGCCGCAAGTGCTGGATCGGATACGCCATCCTGCTCATCCACGCCGCCGTCCTCGTCCTCGGCTTCTTT
CTCTCGGCGCTCAAGACCATGGTCGAGGTTCTGGCCCGTCTACTCGGCGCCGGTGGCGATGACGTCGTCGGTCTA
CGTCGCGGTGGCCTCTCCAAGATATTCGGCATGCGCCAGCTCTCGCGGCGAGAGACGCACCGCCCGGGCATCTCG
CGCGCCAGTCACATGTCGACGGCCGCCATCTTGGAGATGGAGGACGGCAGCAGAGCCGCGGCCGGCAGCAGGATG
CGGTCCGCCTCGACGGCCAGCCTCTCGCAGCACCTCTCCCACAACCAGAACCTCCACCATCGACAGCGGAGCAGC
TCGGCGCTCGACAGCATCGATCTCTACGCCGGCGGCGGGTCGCGCAACGCCGATCACTCCGTCAGCGGTGTCTCG
TACGCGCCCGGCGAGACGGCCTTTTCCTTCCTGGCTTCGCCGCGGCAGGCCGTCTCTCCCACCGCCGCCGTCGAG
GCCGCTGACCCGTACTATCGCCCTCCGCGGCGGCGGCGAGATACGCTGAGCGCCGGGGAGGCGGCCTACACGGAC
GCGCCGCGCGCCGGCGAGGTCGAGCCGAAGCGGCCGATACAAGGCCCCGGCCCCGGCTCCGGCCCCGGCTTGTCG
GGCGAAGTGGGCCTCGAGCTCCCGGAGGAGGTGGCTCGGGGCGCTACGACGACGCAGCTGCCGCTCAACGTGGTC
ACGATGGATTTCCCGCCCAATCGTCCGGATTACTCGACGCGCGAGGTCGACTTTTACTACGGCGTTCGCGGACCG
GCTCTCAACTCCGTCGGCCCCGGCAGGAAGTTGGGGACGGGGCCAGCGGATCCGACGGGGCCCGTTGCCACCGCC
ACCGGCTGGTTCCGCAACATGTTCAAGGGCAAGAAGACCAAGGAAAAGGGCAAGGGCTTCGAGGTGGTTCGCAGC
TCGAGGATGCCGCCCGCCAGCTTCGGCGACGAGACGCCGCCCGAGGGCATCCCCGTCGCCATGGGCGTCCTGAGG
AACGGGCCCATTGACTCGGACGACGACTCGCTCGACGGCCGTAAGCCGAGGAGGCGTCGACCGGACCATCTTTTG
ACGGACGCGGGCGATGCGCAGTCTTCGGACACTAGCGGGCCGAACAGTCCCGTCGAGGAGGGGGCGGGAGGAGAT
GGCGATGACGGGACGGGCCGGCTGATTAGCCCCTTGGAAGATGACGTTGTCGACGATGATGAGGACGGGGATGGG
GATGAGAAAGAGGATGAAGGATTCGACCTTCCCGTCATCCCACGCAAAAGCTCCAAGAGAAACTCTGGCTCAATG
GACCGCAGCCGTCACCCCATCCTAACCCTCCCAGCCATCGACTCCTCAGACACGGAAACACAACATCAACAGCAG
CAACGACACCAACAACCCCGCCTCTGCCCTCTCTCCCTGCAACCCCCTCAAGCCCCTTGTCCTCCCCACCCCTCC
CCTCCAACCCGCTCGGCCGACCGCCCCGCCAGCTTCGGCGTCGTCAGACAGCACGGCATAAGCCGCGTCGATCCG
GGCGAGGCGGTGGATCTGATGGGGAGGAGGGCTGAGGTTATTGATGGGGGGGAGGAGTTTTGA
Transcript >Ophcf2|04635
ATGGCTCGGGACGGGGTTCTCAGAGGGATGCGTCGACGCGAGGGGACGACGACGATCAAGACGACGACGATCAAG
ACGACGACGATCAAGACGAAGACGAAGACGACGATAGACGACGTCCCCAGACGCCACCGCTGTCCCTTCTCATCG
CGACGCCACAACCTCCCTGAAAGGCGCTCGGCTCGCGCCCGCCCCGCCAGCTCACTCCTCGTCATCGCCCTCACC
CTCCTCCTCCTCCTCCTCCTCTCAGCCTCTCCCGCATCAGCAGCACGCGTCCCCGTGGCCTCGTGCTTGAGCTCG
GCTCCCTCCCAGCTACAATGGCGACCGCTATTCGCCGACGCCCGCTTCAGCGGCGCCGACAACAACTACCGGCTC
GAGCTGGTGGTTTGGGGCAACGTCTCGGGGTCGCTCGACCAGGCGGCGTCTTTGCCTCCTGCGGGGGATTCGCAT
TGGACGAGGCCCCAAGAAACGGAGGGCAAGATTGCTGATTCGGCGGATAAGCCTGACGTGGAGAGTCGGAAGGCG
ACGACGTTGATTCGCAAGGTTAATGTATTGACGTATGAGGTTTGGGCTGATGAGCCTGTGAGCTTTTGCAAGAAG
GGGCTCGTCAATGGGACGTGTCCGTTGGGGCCGGTCTTTGACGATGGGGCCCTCACCTCTCCTCGCGGCCTCCTC
CCCTCGGTCAACCTCAGTCACGACTTCTTCTCTCCTTACTCCTTCGCCTCCTTCGCCCCGACGATCCGCATCATC
TACGGCGACGCAAAGGCCACCGATGTCGGCTGCATTACAGCCGTCGTCACCCCGGACCTGGCCTCGGTAGCCTGG
CTGCCGCGTTTCCTACCGCTCGTCATCCTCCTCATCTCGGGTCTGGCCGTCGTCTTGGCCGCCGTCTTCAGCCCC
TGGGGCTCAACCAGTATAGTCCACTGGTCTTCCAACTACGGCCGAGACGCCGACCTGCTACGCCTCGTCACCCCC
GGCTTCGGCGATTGCCTGCAGTACATCCAGTTCGTCGTCCTCACTGGCGCCCTCTCCCTCAGCTACCCGGGCTAC
TACCAGCCCGTCGTCGCCCAGGCCGCCTGGTCGGCTCTCATGTTCAACCAGAGCGTCGTCACCGGCGCGCTCTCG
TGGCAGAGCGTCGTCGACGGCATCTACGTCACAAACAGCTCCGACGGCCATGGCCTGCAGCAGCTCGGCCAGCTC
GCCGGCATGGCCCGCAGCGCCGACGTCTGGCCGGGGTTCATGGTCTGCCTGGGAGTCATCCTCGTCGGCCTCTTC
GTCGCGATCCAGACCGGATTCCTTGCCCGCTGGCTTTGGAGGAGACTCTACCACATCCCCGAGGAGGACCTGCGG
GCCAAGAACGTGCCCTTTACCGTCGGTAACCTCGTCCGCACCGTCTTCAACTACATGCTCGTCCCCATCGTTGCC
CTCTCCTGCTTCCAGCTCGTCGTGGCCCGCTCGTCTCCCGCCTTTACCGTCGCCCTCGCCGTTCTGACGCTCGTC
CTGCTCCTCGTCTCGGCCGCCTGGATGCTGGCCCTCGTCATCCGCACCCGGCCCAAGTCGGTCCTCTTCGACGAC
CTGCCCACGCTCCTCCGCATCGGGCCCCTCTACAACACCTACTCGGATCAGGTGGCCGCCTTTGCCCTCATCCCC
GTCGTCCTCAACCTGATGCGCGGCATCGCCATCGGCGCCGTCCAGCCCAGCGGCGTCGCTCAGGTCGTCCTGCTC
GCCATCTGCGAGGTCATCCAGGTCTTTACCCTCCACGCCTTCCGTCCCTTTCCCGCGCCCACGTCCATGAACGCC
TACCACACCGTCTTCTCCCTCCTGAGGGCCGTCACCCTGCTGCTGATGGTGGCCTTTGTCCCCAGCCTTGGCGTC
GCCGAGGGCCGCAAGTGCTGGATCGGATACGCCATCCTGCTCATCCACGCCGCCGTCCTCGTCCTCGGCTTCTTT
CTCTCGGCGCTCAAGACCATGGTCGAGGTTCTGGCCCGTCTACTCGGCGCCGGTGGCGATGACGTCGTCGGTCTA
CGTCGCGGTGGCCTCTCCAAGATATTCGGCATGCGCCAGCTCTCGCGGCGAGAGACGCACCGCCCGGGCATCTCG
CGCGCCAGTCACATGTCGACGGCCGCCATCTTGGAGATGGAGGACGGCAGCAGAGCCGCGGCCGGCAGCAGGATG
CGGTCCGCCTCGACGGCCAGCCTCTCGCAGCACCTCTCCCACAACCAGAACCTCCACCATCGACAGCGGAGCAGC
TCGGCGCTCGACAGCATCGATCTCTACGCCGGCGGCGGGTCGCGCAACGCCGATCACTCCGTCAGCGGTGTCTCG
TACGCGCCCGGCGAGACGGCCTTTTCCTTCCTGGCTTCGCCGCGGCAGGCCGTCTCTCCCACCGCCGCCGTCGAG
GCCGCTGACCCGTACTATCGCCCTCCGCGGCGGCGGCGAGATACGCTGAGCGCCGGGGAGGCGGCCTACACGGAC
GCGCCGCGCGCCGGCGAGGTCGAGCCGAAGCGGCCGATACAAGGCCCCGGCCCCGGCTCCGGCCCCGGCTTGTCG
GGCGAAGTGGGCCTCGAGCTCCCGGAGGAGGTGGCTCGGGGCGCTACGACGACGCAGCTGCCGCTCAACGTGGTC
ACGATGGATTTCCCGCCCAATCGTCCGGATTACTCGACGCGCGAGGTCGACTTTTACTACGGCGTTCGCGGACCG
GCTCTCAACTCCGTCGGCCCCGGCAGGAAGTTGGGGACGGGGCCAGCGGATCCGACGGGGCCCGTTGCCACCGCC
ACCGGCTGGTTCCGCAACATGTTCAAGGGCAAGAAGACCAAGGAAAAGGGCAAGGGCTTCGAGGTGGTTCGCAGC
TCGAGGATGCCGCCCGCCAGCTTCGGCGACGAGACGCCGCCCGAGGGCATCCCCGTCGCCATGGGCGTCCTGAGG
AACGGGCCCATTGACTCGGACGACGACTCGCTCGACGGCCGTAAGCCGAGGAGGCGTCGACCGGACCATCTTTTG
ACGGACGCGGGCGATGCGCAGTCTTCGGACACTAGCGGGCCGAACAGTCCCGTCGAGGAGGGGGCGGGAGGAGAT
GGCGATGACGGGACGGGCCGGCTGATTAGCCCCTTGGAAGATGACGTTGTCGACGATGATGAGGACGGGGATGGG
GATGAGAAAGAGGATGAAGGATTCGACCTTCCCGTCATCCCACGCAAAAGCTCCAAGAGAAACTCTGGCTCAATG
GACCGCAGCCGTCACCCCATCCTAACCCTCCCAGCCATCGACTCCTCAGACACGGAAACACAACATCAACAGCAG
CAACGACACCAACAACCCCGCCTCTGCCCTCTCTCCCTGCAACCCCCTCAAGCCCCTTGTCCTCCCCACCCCTCC
CCTCCAACCCGCTCGGCCGACCGCCCCGCCAGCTTCGGCGTCGTCAGACAGCACGGCATAAGCCGCGTCGATCCG
GGCGAGGCGGTGGATCTGATGGGGAGGAGGGCTGAGGTTATTGATGGGGGGGAGGAGTTTTGA
Gene >Ophcf2|04635
ATGGCTCGGGACGGGGTTCTCAGAGGGATGCGTCGACGCGAGGGGACGACGACGATCAAGACGACGACGATCAAG
ACGACGACGATCAAGACGAAGACGAAGACGACGATAGACGACGTCCCCAGACGCCACCGCTGTCCCTTCTCATCG
CGACGCCACAACCTCCCTGAAAGGCGCTCGGCTCGCGCCCGCCCCGCCAGCTCACTCCTCGTCATCGCCCTCACC
CTCCTCCTCCTCCTCCTCCTCTCAGCCTCTCCCGCATCAGCAGCACGCGTCCCCGTGGCCTCGTGCTTGAGCTCG
GCTCCCTCCCAGCTACAATGGCGACCGCTATTCGCCGACGCCCGCTTCAGCGGCGCCGACAACAACTACCGGCTC
GAGCTGGTGGTTTGGGGCAACGTCTCGGGGTCGCTCGACCAGGCGGCGTCTTTGCCTCCTGCGGGGGATTCGCAT
TGGACGAGGCCCCAAGAAACGGAGGGCAAGATTGCTGATTCGGCGGATAAGCCTGACGTGGAGAGTCGGAAGGCG
ACGACGTTGATTCGCAAGGTTAATGTATTGACGTATGAGGTTTGGGCTGATGAGCCTGTGAGCTTTTGCAAGAAG
GGGCTCGTCAATGGGACGTGTCCGTTGGGGCCGGTCTTTGACGATGGGGCCCTGTACGGATTCCTTTCTCTTCTT
CCTCTTCTTCTTCTTCTTCGTCTCGTGTCCACTGACGACGAGGCACAGCACCTCTCCTCGCGGCCTCCTCCCCTC
GGTCAACCTCAGTCACGACTTCTTCTCTCCTTACTCCTTCGCCTCCTTCGCCCCGACGATCCGCATCATCTACGG
CGACGCAAAGGCCACCGATGTCGGCTGCATTACAGCCGTCGTCACCCCGGACCTGGCCTCGGTAGCCTGGCTGCC
GCGTTTCCTACCGCTCGTCATCCTCCTCATCTCGGGTCTGGCCGTCGTCTTGGCCGCCGTCTTCAGCCCCTGGGG
CTCAACCAGTATAGTCCACTGGTCTTCCAACTACGGCCGAGACGCCGACCTGCTACGCCTCGTCACCCCCGGCTT
CGGCGATTGCCTGCAGTACATCCAGTTCGTCGTCCTCACTGGCGCCCTCTCCCTCAGCTACCCGGGCTACTACCA
GCCCGTCGTCGCCCAGGCCGCCTGGTCGGCTCTCATGTTCAACCAGAGCGTCGTCACCGGCGCGCTCTCGTGGCA
GAGCGTCGTCGACGGCATCTACGTCACAAACAGCTCCGACGGCCATGGCCTGCAGCAGCTCGGCCAGCTCGCCGG
CATGGCCCGCAGCGCCGACGTCTGGCCGGGGTTCATGGTCTGCCTGGGAGTCATCCTCGTCGGCCTCTTCGTCGC
GATCCAGACCGGATTCCTTGCCCGCTGGCTTTGGAGGAGACTCTACCACATCCCCGAGGAGGACCTGCGGGCCAA
GAACGTGCCCTTTACCGTCGGTAACCTCGTCCGCACCGTCTTCAACTACATGCTCGTCCCCATCGTTGCCCTCTC
CTGCTTCCAGCTCGTCGTGGCCCGCTCGTCTCCCGCCTTTACCGTCGCCCTCGCCGTTCTGACGCTCGTCCTGCT
CCTCGTCTCGGCCGCCTGGATGCTGGCCCTCGTCATCCGCACCCGGCCCAAGTCGGTCCTCTTCGACGACCTGCC
CACGCTCCTCCGCATCGGGCCCCTCTACAACACCTACTCGGATCAGGTGGCCGCCTTTGCCCTCATCCCCGTCGT
CCTCAACCTGATGCGCGGCATCGCCATCGGCGCCGTCCAGCCCAGCGGCGTCGCTCAGGTCGTCCTGCTCGCCAT
CTGCGAGGTCATCCAGGTCTTTACCCTCCACGCCTTCCGTCCCTTTCCCGCGCCCACGTCCATGAACGCCTACCA
CACCGTCTTCTCCCTCCTGAGGGCCGTCACCCTGCTGCTGATGGTGGCCTTTGTCCCCAGCCTTGGCGTCGCCGA
GGGCCGCAAGTGCTGGATCGGATACGCCATCCTGCTCATCCACGCCGCCGTCCTCGTCCTCGGCTTCTTTCTCTC
GGCGCTCAAGACCATGGTCGAGGTTCTGGCCCGTCTACTCGGCGCCGGTGGCGATGACGTCGTCGGTCTACGTCG
CGGTGGCCTCTCCAAGATATTCGGCATGCGCCAGCTCTCGCGGCGAGAGACGCACCGCCCGGGCATCTCGCGCGC
CAGTCACATGTCGACGGCCGCCATCTTGGAGATGGAGGACGGCAGCAGAGCCGCGGCCGGCAGCAGGATGCGGTC
CGCCTCGACGGCCAGCCTCTCGCAGCACCTCTCCCACAACCAGAACCTCCACCATCGACAGCGGAGCAGCTCGGC
GCTCGACAGCATCGATCTCTACGCCGGCGGCGGGTCGCGCAACGCCGATCACTCCGTCAGCGGTGTCTCGTACGC
GCCCGGCGAGACGGCCTTTTCCTTCCTGGCTTCGCCGCGGCAGGCCGTCTCTCCCACCGCCGCCGTCGAGGCCGC
TGACCCGTACTATCGCCCTCCGCGGCGGCGGCGAGATACGCTGAGCGCCGGGGAGGCGGCCTACACGGACGCGCC
GCGCGCCGGCGAGGTCGAGCCGAAGCGGCCGATACAAGGCCCCGGCCCCGGCTCCGGCCCCGGCTTGTCGGGCGA
AGTGGGCCTCGAGCTCCCGGAGGAGGTGGCTCGGGGCGCTACGACGACGCAGCTGCCGCTCAACGTGGTCACGAT
GGATTTCCCGCCCAATCGTCCGGATTACTCGACGCGCGAGGTCGACTTTTACTACGGCGTTCGCGGACCGGCTCT
CAACTCCGTCGGCCCCGGCAGGAAGTTGGGGACGGGGCCAGCGGATCCGACGGGGCCCGTTGCCACCGCCACCGG
CTGGTTCCGCAACATGTTCAAGGGCAAGAAGACCAAGGAAAAGGGCAAGGGCTTCGAGGTGGTTCGCAGCTCGAG
GATGCCGCCCGCCAGCTTCGGCGACGAGACGCCGCCCGAGGGCATCCCCGTCGCCATGGGCGTCCTGAGGAACGG
GCCCATTGACTCGGACGACGACTCGCTCGACGGCCGTAAGCCGAGGAGGCGTCGACCGGACCATCTTTTGACGGA
CGCGGGCGATGCGCAGTCTTCGGACACTAGCGGGCCGAACAGTCCCGTCGAGGAGGGGGCGGGAGGAGATGGCGA
TGACGGGACGGGCCGGCTGATTAGCCCCTTGGAAGATGACGTTGTCGACGATGATGAGGACGGGGATGGGGATGA
GAAAGAGGATGAAGGATTCGACCTTCCCGTCATCCCACGCAAAAGCTCCAAGAGAAACTCTGGCTCAATGGACCG
CAGCCGTCACCCCATCCTAACCCTCCCAGCCATCGACTCCTCAGACACGGAAACACAACATCAACAGCAGCAACG
ACACCAACAACCCCGCCTCTGCCCTCTCTCCCTGCAACCCCCTCAAGCCCCTTGTCCTCCCCACCCCTCCCCTCC
AACCCGCTCGGCCGACCGCCCCGCCAGCTTCGGCGTCGTCAGACAGCACGGCATAAGCCGCGTCGATCCGGGCGA
GGCGGTGGATCTGATGGGGAGGAGGGCTGAGGTTATTGATGGGGGGGAGGAGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail