Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04622
Gene name
Locationscaffold_04:3730664..3731301
Strand-
Gene length (bp)637
Transcript length (bp)330
Coding sequence length (bp)330
Protein length (aa) 110

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 22.18 4.47 39.90
Alive In ants, during behavior modification 23.57 3.29 43.85
Dead In ants, recently dead 28.29 6.41 50.17

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.900420 no
Alive Dead 0.613394 no
Dead Fungus 0.528101 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04622
MPIHLKCLDCYDSFLALPMADATSSPFVLFVHIFYHFCVLRIFWPLANSDGEDEHHRKARERHGKAEDAELTTIM
ASAVDHARLLLTKMSETHHAAAIAADNLQPRSSS*
Coding >Ophcf2|04622
ATGCCTATACATCTCAAGTGTCTCGACTGCTATGACAGCTTCTTGGCCTTGCCCATGGCGGACGCGACCAGCTCG
CCGTTCGTACTGTTCGTTCACATCTTCTATCATTTCTGCGTCCTTCGCATCTTCTGGCCCCTAGCCAACAGCGAT
GGCGAAGACGAACACCACCGAAAAGCCCGCGAGCGGCATGGCAAGGCCGAGGATGCCGAGCTGACTACAATCATG
GCGTCGGCCGTTGACCATGCCCGTCTGCTGCTAACCAAGATGAGCGAGACGCATCACGCTGCCGCCATAGCCGCG
GACAATCTCCAGCCCAGGTCTTCCTCTTGA
Transcript >Ophcf2|04622
ATGCCTATACATCTCAAGTGTCTCGACTGCTATGACAGCTTCTTGGCCTTGCCCATGGCGGACGCGACCAGCTCG
CCGTTCGTACTGTTCGTTCACATCTTCTATCATTTCTGCGTCCTTCGCATCTTCTGGCCCCTAGCCAACAGCGAT
GGCGAAGACGAACACCACCGAAAAGCCCGCGAGCGGCATGGCAAGGCCGAGGATGCCGAGCTGACTACAATCATG
GCGTCGGCCGTTGACCATGCCCGTCTGCTGCTAACCAAGATGAGCGAGACGCATCACGCTGCCGCCATAGCCGCG
GACAATCTCCAGCCCAGGTCTTCCTCTTGA
Gene >Ophcf2|04622
ATGCCTATACATCTCAAGTGTCTCGACTGCTATGACAGCTTCTTGGCCTTGCCCATGGCGGACGCGACCAGCTCG
CCGTTCGTACTGTTCGTTCAGTGAGGAACTACCTAACCCTTACTTCTCCCTCTGAGTTGTCGCTTTTCTTTTCCG
TCTTCTGTTGTCTGAAGGTTTCCTGTTGTCGACGTCCTCTCTCATGTTCGGTGTTTACGATCCTTGAAGCATCTT
CTATCATTTCTGCGTCCTTCGCATCTTCTGGCCCCTAGCCAACAGCGATGGCGAAGACGAACACCACCGAAAAGC
CCGCGAGCGGCATGTGCGTCTAGGCAACCGAGTGCATTCTCCGACTGTCCAGCTCGTACGCAGCCCTCTTTGTTC
TGCGCCACGTCTCCCCCTTTGTCGTCTACTTCATCCTCGTCTCGGACCCCTTCAGCCACGAGGCCGACGACCAGC
CCTACGTCAACAACCGTGTTCTCATGGCCTTGCTGACGACAAAAAGGGCAAGGCCGAGGATGCCGAGCTGACTAC
AATCATGGCGTCGGCCGTTGACCATGCCCGTCTGCTGCTAACCAAGATGAGCGAGACGCATCACGCTGCCGCCAT
AGCCGCGGACAATCTCCAGCCCAGGTCTTCCTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail