Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04618
Gene name
Locationscaffold_04:3719204..3720901
Strand+
Gene length (bp)1697
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.2E-19 58 246
PF00083 Sugar_tr Sugar (and other) transporter 1.5E-09 265 454
PF07690 MFS_1 Major Facilitator Superfamily 7.0E-12 83 319

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 86 108 22
2 118 137 19
3 187 209 22
4 219 238 19
5 258 280 22
6 308 330 22
7 337 357 20
8 367 389 22
9 402 424 22
10 439 461 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 117.85 65.96 169.74
Alive In ants, during behavior modification 118.96 66.00 171.92
Dead In ants, recently dead 103.08 56.99 149.17

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.972930 no
Alive Dead 0.425037 no
Dead Fungus 0.534676 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04618
MAIFSRFIGRHRPESSDAVAKTETPPVGDDALVEAQVDERSFLQKAMPVFACGAGLFSDGYINNVIGSVNTVLRL
QYGDVYKNTTAASNVTAIAFAGTVVGQLVFGFASDRWSRSNSLMTSTVILIVFTALAAGSYYHGDPVAMFSMLAA
WRFFVGIGIGGEYPAGSVACAESSGELRSGTRNRWFILFTNSMIDWGFVFGAFIPYVVAAAAQNRNYSTIWRTSL
GIGVVFPLALLLMRMRLKEPEEFARESMRRKTPYLLVLRYYWFRLFCVSLVWFLYDFSTYAFGIYVSSILSAIYG
DNASLTTVFGWTTVINTFYLPGTLFGALVSDWLGPKYTLIGGVTVQAIVGFIMAAVYDRISHNVAAFAVIYGLFL
TLGELGPGNNIGLLAAKTCATGVRGRYYGISAAIGKIGAFVGSYVFPYIQAAGGASGSVQSAQYPFYVASSFCIL
SAAIAMCIPNIGQDTITREDAEFRAYLEAKGWDTSLLGLAKDDSQAVTYAEDENQRQEPTKQQ*
Coding >Ophcf2|04618
ATGGCCATCTTCAGCCGCTTCATCGGCCGCCATCGTCCCGAGTCCTCGGACGCGGTTGCAAAGACTGAAACCCCC
CCGGTCGGAGACGATGCCCTTGTCGAGGCGCAGGTCGATGAAAGGTCATTTCTCCAAAAGGCCATGCCCGTCTTC
GCCTGCGGGGCTGGTCTCTTCTCCGACGGTTACATCAACAATGTCATCGGCTCCGTCAACACAGTCCTCCGGCTC
CAATACGGCGACGTATACAAGAACACGACAGCAGCCTCCAACGTGACCGCCATTGCCTTTGCCGGCACCGTCGTC
GGTCAGCTCGTCTTCGGCTTCGCCTCGGATCGATGGTCTCGCTCCAACTCGCTCATGACGTCGACAGTCATCCTC
ATCGTCTTTACCGCCCTCGCCGCCGGCTCCTACTATCATGGCGATCCCGTTGCCATGTTCAGCATGCTGGCTGCC
TGGCGCTTCTTCGTGGGCATCGGTATAGGTGGCGAGTATCCAGCCGGCAGCGTCGCCTGCGCCGAGTCGAGCGGC
GAGCTGCGTAGCGGGACGCGGAACCGATGGTTCATCCTCTTTACCAACAGCATGATTGACTGGGGCTTCGTCTTT
GGCGCCTTTATCCCTTATGTCGTCGCTGCGGCTGCCCAGAACCGCAACTACTCGACCATTTGGCGCACCAGCCTC
GGCATCGGCGTCGTCTTCCCTCTCGCCCTGCTGCTGATGCGCATGCGCCTCAAGGAGCCGGAAGAGTTCGCGCGC
GAGTCGATGCGACGCAAGACGCCATATCTGCTGGTGCTGCGCTACTACTGGTTCCGTCTGTTTTGCGTCAGCCTC
GTCTGGTTCCTCTACGATTTCAGCACATACGCCTTTGGCATTTACGTCTCGTCAATCCTCAGCGCCATCTACGGC
GACAACGCCTCCCTCACCACCGTCTTCGGCTGGACGACCGTGATAAACACCTTTTACCTGCCAGGCACCTTGTTT
GGCGCCCTCGTCAGCGACTGGCTGGGCCCCAAGTACACGCTCATCGGGGGCGTCACCGTCCAGGCCATCGTCGGC
TTCATCATGGCCGCCGTCTACGACCGCATCTCACACAACGTTGCCGCCTTCGCCGTCATCTACGGCCTCTTCCTC
ACCCTTGGCGAGCTCGGTCCGGGCAACAACATCGGCTTACTGGCAGCTAAGACGTGCGCGACGGGCGTCCGCGGC
CGCTACTATGGCATTTCCGCCGCCATCGGCAAGATTGGAGCCTTTGTCGGTTCCTACGTCTTCCCTTACATCCAG
GCTGCCGGCGGCGCCTCCGGCTCGGTCCAGTCGGCGCAGTATCCGTTCTACGTCGCGTCCAGCTTCTGCATCCTG
TCGGCCGCCATCGCCATGTGCATCCCCAACATCGGCCAGGACACCATCACGCGCGAAGACGCCGAGTTCCGGGCC
TATCTCGAGGCCAAGGGGTGGGACACGTCCTTGCTGGGGCTTGCCAAGGACGACTCGCAGGCGGTGACCTATGCC
GAGGACGAGAATCAGCGGCAGGAGCCTACGAAGCAGCAGTAG
Transcript >Ophcf2|04618
ATGGCCATCTTCAGCCGCTTCATCGGCCGCCATCGTCCCGAGTCCTCGGACGCGGTTGCAAAGACTGAAACCCCC
CCGGTCGGAGACGATGCCCTTGTCGAGGCGCAGGTCGATGAAAGGTCATTTCTCCAAAAGGCCATGCCCGTCTTC
GCCTGCGGGGCTGGTCTCTTCTCCGACGGTTACATCAACAATGTCATCGGCTCCGTCAACACAGTCCTCCGGCTC
CAATACGGCGACGTATACAAGAACACGACAGCAGCCTCCAACGTGACCGCCATTGCCTTTGCCGGCACCGTCGTC
GGTCAGCTCGTCTTCGGCTTCGCCTCGGATCGATGGTCTCGCTCCAACTCGCTCATGACGTCGACAGTCATCCTC
ATCGTCTTTACCGCCCTCGCCGCCGGCTCCTACTATCATGGCGATCCCGTTGCCATGTTCAGCATGCTGGCTGCC
TGGCGCTTCTTCGTGGGCATCGGTATAGGTGGCGAGTATCCAGCCGGCAGCGTCGCCTGCGCCGAGTCGAGCGGC
GAGCTGCGTAGCGGGACGCGGAACCGATGGTTCATCCTCTTTACCAACAGCATGATTGACTGGGGCTTCGTCTTT
GGCGCCTTTATCCCTTATGTCGTCGCTGCGGCTGCCCAGAACCGCAACTACTCGACCATTTGGCGCACCAGCCTC
GGCATCGGCGTCGTCTTCCCTCTCGCCCTGCTGCTGATGCGCATGCGCCTCAAGGAGCCGGAAGAGTTCGCGCGC
GAGTCGATGCGACGCAAGACGCCATATCTGCTGGTGCTGCGCTACTACTGGTTCCGTCTGTTTTGCGTCAGCCTC
GTCTGGTTCCTCTACGATTTCAGCACATACGCCTTTGGCATTTACGTCTCGTCAATCCTCAGCGCCATCTACGGC
GACAACGCCTCCCTCACCACCGTCTTCGGCTGGACGACCGTGATAAACACCTTTTACCTGCCAGGCACCTTGTTT
GGCGCCCTCGTCAGCGACTGGCTGGGCCCCAAGTACACGCTCATCGGGGGCGTCACCGTCCAGGCCATCGTCGGC
TTCATCATGGCCGCCGTCTACGACCGCATCTCACACAACGTTGCCGCCTTCGCCGTCATCTACGGCCTCTTCCTC
ACCCTTGGCGAGCTCGGTCCGGGCAACAACATCGGCTTACTGGCAGCTAAGACGTGCGCGACGGGCGTCCGCGGC
CGCTACTATGGCATTTCCGCCGCCATCGGCAAGATTGGAGCCTTTGTCGGTTCCTACGTCTTCCCTTACATCCAG
GCTGCCGGCGGCGCCTCCGGCTCGGTCCAGTCGGCGCAGTATCCGTTCTACGTCGCGTCCAGCTTCTGCATCCTG
TCGGCCGCCATCGCCATGTGCATCCCCAACATCGGCCAGGACACCATCACGCGCGAAGACGCCGAGTTCCGGGCC
TATCTCGAGGCCAAGGGGTGGGACACGTCCTTGCTGGGGCTTGCCAAGGACGACTCGCAGGCGGTGACCTATGCC
GAGGACGAGAATCAGCGGCAGGAGCCTACGAAGCAGCAGTAG
Gene >Ophcf2|04618
ATGGCCATCTTCAGCCGCTTCATCGGCCGCCATCGTCCCGAGTCCTCGGACGCGGTTGCAAAGACTGAAACCCCC
CCGGTCGGAGACGATGCCCTTGTCGAGGCGCAGGTCGATGAAAGGTCATTTCTCCAAAAGGCCATGCCCGTCTTC
GCCTGCGGGGCTGGTCTCTTCTCCGACGGTTACATCAACAATGTGAGTCTTGCCCTCTTCGTCGTCAGGAACAAA
GGGACTGAATACGGCCCAGGTCATCGGCTCCGTCAACACAGTCCTCCGGCTCCAATACGGCGACGTATACAAGAA
CACGACAGCAGCCTCCAACGTGACCGCCATTGCCTTTGCCGGCACCGTCGTCGGTCAGCTCGTCTTCGGCTTCGC
CTCGGATCGATGGTCTCGCTCCAACTCGCTCATGACGTCGACAGTCATCCTCATCGTCTTTACCGCCCTCGCCGC
CGGCTCCTACTATCATGGCGATCCCGTTGCCATGTTCAGCATGCTGGCTGCCTGGCGCTTCTTCGTGGGCATCGG
TATAGGTGGCGAGTATCCAGCCGGCAGCGTCGCCTGCGCCGAGTCGAGCGGCGAGCTGCGTAGCGGGACGCGGAA
CCGATGGTTCATCCTCTTTACCAACAGCATGATTGACTGGGGCTTCGTCTTTGGCGCCTTTATCCCTTGTGAGTC
CCAGTCTTGCACTCGTCTCTTCCGTCGTCTTACTTACATCTGTAGATGTCGTCGCTGCGGCTGCCCAGAACCGCA
ACTACTCGACCATTTGGCGCACCAGCCTCGGCATCGGCGTCGTCTTCCCTCTCGCCCTGCTGCTGATGCGCATGC
GCCTCAAGGAGCCGGAAGAGTTCGCGCGCGAGTCGATGCGACGCAAGACGCCATATCTGCTGGTGCTGCGCTACT
ACTGGTTCCGTCTGTTTTGCGTCAGCCTCGTCTGGTTCCTCTACGATGTGAGTTTCTCCTCTCTCCCTATAGAAG
CTCGACGTCTCACCCCTACAAAGTTCAGCACATACGCCTTTGGCATTTACGTCTCGTCAATCCTCAGCGCCATCT
ACGGCGACAACGCCTCCCTCACCACCGTCTTCGGCTGGACGACCGTGATAAACACCTTTTACCTGCCAGGCACCT
TGTTTGGCGCCCTCGTCAGCGACTGGCTGGGCCCCAAGTACACGCTCATCGGGGGCGTCACCGTCCAGGCCATCG
TCGGCTTCATCATGGCCGCCGTCTACGACCGCATCTCACACAACGTTGCCGCCTTCGCCGTCATCTACGGCCTCT
TCCTCACCCTTGGCGAGCTCGGTCCGGGCAACAACATCGGCTTACTGGCAGCTAAGACGTGCGCGACGGGCGTCC
GCGGCCGCTACTATGGCATTTCCGCCGCCATCGGCAAGATTGGAGCCTTTGTCGGTTCCTACGTCTTCCCTTACA
TCCAGGCTGCCGGCGGCGCCTCCGGCTCGGTCCAGTCGGCGCAGTATCCGTTCTACGTCGCGTCCAGCTTCTGCA
TCCTGTCGGCCGCCATCGCCATGTGCATCCCCAACATCGGCCAGGACACCATCACGCGCGAAGACGCCGAGTTCC
GGGCCTATCTCGAGGCCAAGGGGTGGGACACGTCCTTGCTGGGGCTTGCCAAGGACGACTCGCAGGCGGTGACCT
ATGCCGAGGACGAGAATCAGCGGCAGGAGCCTACGAAGCAGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail