Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04617
Gene name
Locationscaffold_04:3716202..3718476
Strand-
Gene length (bp)2274
Transcript length (bp)1968
Coding sequence length (bp)1968
Protein length (aa) 656

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 5.8E-10 324 418

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0046483 heterocycle metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0005488 binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043169 cation binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0019438 aromatic compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:0090304 nucleic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0046872 metal ion binding No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0046914 transition metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 564 583 19

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 31.76 17.78 45.74
Alive In ants, during behavior modification 33.81 18.72 48.90
Dead In ants, recently dead 33.76 18.95 48.56

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.794534 no
Alive Dead 0.993863 no
Dead Fungus 0.795489 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04617
MWQRRSRLGAGGFVWIDASRREDEARESFHIADPVHTARRNGSPRRTEFSSQIPNRHAGRALRKGPPKGPPKGPR
LPPPLPSSQATLADSSLASDPRKIQCDAAQTRSRCDWCRHHGIPCTFVRPASRSTPVRAKTITPASASAPPPAPA
PPCTPPALDGRRLNAAALGQIYVAGRNLGSFCSRSGIPYFTPEGERRIHSQTGRWPSLRRRSPNDAEQQPLKPPR
APGFDLPDRSVVESLLATYLASDFRLVFPLIDGTLFCRTLNQAYSSAVTFQSRCARACVFAFLSIASSSRFLGAD
VQPVVDGQECATEASALLRGTLEMANVVVVQTLLILLTHETICGRLQAASMYHALACRSLFTLNAHVQVGDDGDR
ERRHLRVLFWFSYVFDKDVALCTGRPPIMDDDFCDLTPPARYDDGLSAHDDSSPWFPGDLRLSVLKSRACRQLYS
AASLRKPEADLLRTIRELDEALEGWRLSLPAGFCPSLAPGSSAGLNRSRGMLHMELHLHYYYLVNVIHAAAGRCA
LADGSGEAVRSSLDLSVEASRATLLYLSMTAHRLISEGFWVFIFYPMSAVVTLFFHVLRDPSDAQAAADVRLLSQ
ASDVIKTMPVGSITARERAYLLEVDGGEGRVSSDWTGLDWAGLGWAGVTLLGYWR*
Coding >Ophcf2|04617
ATGTGGCAGCGGAGGAGTCGCCTTGGCGCTGGTGGGTTCGTGTGGATCGACGCGTCAAGGAGAGAGGACGAGGCG
CGTGAGAGCTTCCACATAGCTGACCCTGTTCATACAGCCAGACGCAATGGATCTCCGAGACGGACAGAGTTCAGC
AGCCAAATTCCAAATCGCCATGCCGGCCGAGCCCTCCGAAAGGGCCCCCCGAAGGGCCCTCCGAAAGGCCCTCGT
CTCCCACCCCCTCTCCCGTCCTCGCAGGCGACGCTCGCAGACTCGTCCCTTGCATCGGACCCTCGCAAGATCCAG
TGCGACGCAGCCCAGACGCGATCCCGCTGTGACTGGTGTCGCCATCATGGCATCCCATGCACTTTTGTACGGCCC
GCCTCGCGTTCCACTCCGGTCCGCGCCAAGACCATCACTCCGGCTTCTGCTTCGGCTCCGCCACCGGCTCCGGCT
CCGCCTTGTACGCCGCCGGCGCTCGACGGCCGACGACTCAACGCCGCGGCTCTCGGGCAGATTTACGTGGCGGGC
CGCAATCTAGGATCCTTCTGCTCCCGCAGCGGCATCCCCTACTTCACGCCCGAGGGTGAACGCCGCATCCACTCT
CAGACGGGCCGCTGGCCGAGTCTCCGGCGACGGAGCCCGAACGATGCCGAGCAGCAGCCGCTCAAGCCGCCGCGG
GCGCCAGGGTTCGATCTGCCGGACAGGTCTGTGGTCGAGTCGCTGCTGGCCACGTATCTGGCGTCGGACTTTCGC
CTCGTCTTCCCCCTCATCGACGGGACGCTGTTTTGCCGCACGCTCAACCAGGCGTATTCGTCCGCGGTGACGTTT
CAGAGCCGATGCGCCAGAGCCTGCGTCTTTGCCTTTTTGTCGATTGCCAGCAGCTCGCGCTTCTTGGGCGCCGAT
GTGCAGCCCGTGGTTGACGGCCAGGAGTGCGCGACCGAGGCTTCGGCGCTGCTGAGGGGCACCCTGGAGATGGCC
AACGTGGTGGTGGTTCAGACGCTGTTGATTCTCCTCACGCATGAGACAATCTGCGGTCGGCTACAGGCCGCGTCC
ATGTATCACGCCCTCGCGTGTCGTAGCCTCTTTACGCTGAACGCGCATGTGCAGGTGGGCGACGACGGCGATCGC
GAGCGGCGACACCTACGCGTACTCTTCTGGTTCAGCTACGTCTTCGACAAGGACGTTGCCCTCTGCACCGGGCGA
CCGCCCATCATGGACGACGACTTTTGCGACCTGACGCCGCCGGCGCGATACGACGACGGCCTTTCAGCCCACGAT
GACTCGTCGCCCTGGTTTCCCGGCGACCTGCGGCTCAGCGTGCTCAAGTCGCGGGCATGCCGTCAGCTGTACTCG
GCCGCTTCGCTGCGAAAGCCCGAAGCCGACCTGCTGCGGACGATCCGCGAGCTCGACGAGGCGCTCGAGGGCTGG
CGGCTATCACTCCCTGCCGGCTTCTGCCCTTCGCTGGCGCCTGGGTCTTCGGCCGGGCTGAACCGGTCGCGGGGG
ATGCTTCACATGGAGCTTCACCTGCATTATTACTACCTCGTCAACGTCATCCACGCCGCCGCGGGCCGGTGCGCG
CTGGCCGACGGCAGCGGTGAGGCGGTGCGGTCGAGCCTGGACCTGTCGGTCGAGGCCAGCCGGGCGACGCTGCTG
TACCTGAGCATGACGGCGCACCGTCTCATCAGCGAGGGCTTCTGGGTCTTCATCTTCTATCCCATGTCGGCCGTT
GTCACGCTGTTCTTTCACGTGCTGCGCGACCCTAGCGACGCCCAGGCGGCGGCTGACGTGAGGCTGCTCTCGCAG
GCGTCGGACGTGATCAAGACGATGCCCGTGGGAAGCATCACGGCGAGGGAGAGGGCCTATCTGCTCGAGGTGGAT
GGGGGTGAGGGGAGGGTGAGCTCGGACTGGACTGGACTGGACTGGGCTGGGCTGGGCTGGGCTGGGGTCACTCTG
CTTGGATATTGGAGGTGA
Transcript >Ophcf2|04617
ATGTGGCAGCGGAGGAGTCGCCTTGGCGCTGGTGGGTTCGTGTGGATCGACGCGTCAAGGAGAGAGGACGAGGCG
CGTGAGAGCTTCCACATAGCTGACCCTGTTCATACAGCCAGACGCAATGGATCTCCGAGACGGACAGAGTTCAGC
AGCCAAATTCCAAATCGCCATGCCGGCCGAGCCCTCCGAAAGGGCCCCCCGAAGGGCCCTCCGAAAGGCCCTCGT
CTCCCACCCCCTCTCCCGTCCTCGCAGGCGACGCTCGCAGACTCGTCCCTTGCATCGGACCCTCGCAAGATCCAG
TGCGACGCAGCCCAGACGCGATCCCGCTGTGACTGGTGTCGCCATCATGGCATCCCATGCACTTTTGTACGGCCC
GCCTCGCGTTCCACTCCGGTCCGCGCCAAGACCATCACTCCGGCTTCTGCTTCGGCTCCGCCACCGGCTCCGGCT
CCGCCTTGTACGCCGCCGGCGCTCGACGGCCGACGACTCAACGCCGCGGCTCTCGGGCAGATTTACGTGGCGGGC
CGCAATCTAGGATCCTTCTGCTCCCGCAGCGGCATCCCCTACTTCACGCCCGAGGGTGAACGCCGCATCCACTCT
CAGACGGGCCGCTGGCCGAGTCTCCGGCGACGGAGCCCGAACGATGCCGAGCAGCAGCCGCTCAAGCCGCCGCGG
GCGCCAGGGTTCGATCTGCCGGACAGGTCTGTGGTCGAGTCGCTGCTGGCCACGTATCTGGCGTCGGACTTTCGC
CTCGTCTTCCCCCTCATCGACGGGACGCTGTTTTGCCGCACGCTCAACCAGGCGTATTCGTCCGCGGTGACGTTT
CAGAGCCGATGCGCCAGAGCCTGCGTCTTTGCCTTTTTGTCGATTGCCAGCAGCTCGCGCTTCTTGGGCGCCGAT
GTGCAGCCCGTGGTTGACGGCCAGGAGTGCGCGACCGAGGCTTCGGCGCTGCTGAGGGGCACCCTGGAGATGGCC
AACGTGGTGGTGGTTCAGACGCTGTTGATTCTCCTCACGCATGAGACAATCTGCGGTCGGCTACAGGCCGCGTCC
ATGTATCACGCCCTCGCGTGTCGTAGCCTCTTTACGCTGAACGCGCATGTGCAGGTGGGCGACGACGGCGATCGC
GAGCGGCGACACCTACGCGTACTCTTCTGGTTCAGCTACGTCTTCGACAAGGACGTTGCCCTCTGCACCGGGCGA
CCGCCCATCATGGACGACGACTTTTGCGACCTGACGCCGCCGGCGCGATACGACGACGGCCTTTCAGCCCACGAT
GACTCGTCGCCCTGGTTTCCCGGCGACCTGCGGCTCAGCGTGCTCAAGTCGCGGGCATGCCGTCAGCTGTACTCG
GCCGCTTCGCTGCGAAAGCCCGAAGCCGACCTGCTGCGGACGATCCGCGAGCTCGACGAGGCGCTCGAGGGCTGG
CGGCTATCACTCCCTGCCGGCTTCTGCCCTTCGCTGGCGCCTGGGTCTTCGGCCGGGCTGAACCGGTCGCGGGGG
ATGCTTCACATGGAGCTTCACCTGCATTATTACTACCTCGTCAACGTCATCCACGCCGCCGCGGGCCGGTGCGCG
CTGGCCGACGGCAGCGGTGAGGCGGTGCGGTCGAGCCTGGACCTGTCGGTCGAGGCCAGCCGGGCGACGCTGCTG
TACCTGAGCATGACGGCGCACCGTCTCATCAGCGAGGGCTTCTGGGTCTTCATCTTCTATCCCATGTCGGCCGTT
GTCACGCTGTTCTTTCACGTGCTGCGCGACCCTAGCGACGCCCAGGCGGCGGCTGACGTGAGGCTGCTCTCGCAG
GCGTCGGACGTGATCAAGACGATGCCCGTGGGAAGCATCACGGCGAGGGAGAGGGCCTATCTGCTCGAGGTGGAT
GGGGGTGAGGGGAGGGTGAGCTCGGACTGGACTGGACTGGACTGGGCTGGGCTGGGCTGGGCTGGGGTCACTCTG
CTTGGATATTGGAGGTGA
Gene >Ophcf2|04617
ATGTGGCAGCGGAGGAGTCGCCTTGGCGCTGGTGGGTTCGTGTGGATCGACGCGTCAAGGAGAGAGGACGAGGCG
CGTGAGAGCTTCCACATAGCTGACCCTGTTCGTCTGTCAACCCCTGTCTGTCTCTCTGTGTATGCACATACATAC
ATACATACATACAGATTCCATTTCCTGACTATTTCACAGATACAGCCAGACGCAATGGATCTCCGAGACGGACAG
AGTTCAGCAGCCAAATTCCAAATCGCCATGCCGGCCGAGCCCTCCGAAAGGGCCCCCCGAAGGGCCCTCCGAAAG
GCCCTCGTCTCCCACCCCCTCTCCCGTCCTCGCAGGCGACGCTCGCAGACTCGTCCCTTGCATCGGACCCTGTAG
CCGGTCATCGTCACCATGCCGAGGCCGAGGCGTGCATGCGATGCCTGTTTCAAGCGCAAGGTCACGAATCCATTC
TCCCCCAGTCGTCTCCCACATGGGCTCACAGCTTCTCAACAGATCCAGTGCGACGCAGCCCAGACGCGATCCCGC
TGTGACTGGTGTCGCCATCATGGCATCCCATGCACTTTTGTACGGCCCGCCTCGCGTTCCACTCCGGTCCGCGCC
AAGACCATCACTCCGGCTTCTGCTTCGGCTCCGCCACCGGCTCCGGCTCCGCCTTGTACGCCGCCGGCGCTCGAC
GGCCGACGACTCAACGCCGCGGCTCTCGGGCAGATTTACGTGGCGGGCCGCAATCTAGGATCCTTCTGCTCCCGC
AGCGGCATCCCCTACTTCACGCCCGAGGGTGAACGCCGCATCCACTCTCAGACGGGCCGCTGGCCGAGTCTCCGG
CGACGGAGCCCGAACGATGCCGAGCAGCAGCCGCTCAAGCCGCCGCGGGCGCCAGGGTTCGATCTGCCGGACAGG
TCTGTGGTCGAGTCGCTGCTGGCCACGTATCTGGCGTCGGACTTTCGCCTCGTCTTCCCCCTCATCGACGGGACG
CTGTTTTGCCGCACGCTCAACCAGGCGTATTCGTCCGCGGTGACGTTTCAGAGCCGATGCGCCAGAGCCTGCGTC
TTTGCCTTTTTGTCGATTGCCAGCAGCTCGCGCTTCTTGGGCGCCGATGTGCAGCCCGTGGTTGACGGCCAGGAG
TGCGCGACCGAGGCTTCGGCGCTGCTGAGGGGCACCCTGGAGATGGCCAACGTGGTGGTGGTTCAGACGCTGTTG
ATTCTCGTGAGTCTCCGTCGGAATATAAAAGGACAGCCCGGACTGACCGTTTCAGCTCACGCATGAGACAATCTG
CGGTCGGCTACAGGCCGCGTCCATGTATCACGCCCTCGCGTGTCGTAGCCTCTTTACGCTGAACGCGCATGTGCA
GGTGGGCGACGACGGCGATCGCGAGCGGCGACACCTACGCGTACTCTTCTGGTTCAGCTACGTCTTCGACAAGGA
CGTTGCCCTCTGCACCGGGCGACCGCCCATCATGGACGACGACTTTTGCGACCTGACGCCGCCGGCGCGATACGA
CGACGGCCTTTCAGCCCACGATGACTCGTCGCCCTGGTTTCCCGGCGACCTGCGGCTCAGCGTGCTCAAGTCGCG
GGCATGCCGTCAGCTGTACTCGGCCGCTTCGCTGCGAAAGCCCGAAGCCGACCTGCTGCGGACGATCCGCGAGCT
CGACGAGGCGCTCGAGGGCTGGCGGCTATCACTCCCTGCCGGCTTCTGCCCTTCGCTGGCGCCTGGGTCTTCGGC
CGGGCTGAACCGGTCGCGGGGGATGCTTCACATGGAGCTTCACCTGCATTATTACTACCTCGTCAACGTCATCCA
CGCCGCCGCGGGCCGGTGCGCGCTGGCCGACGGCAGCGGTGAGGCGGTGCGGTCGAGCCTGGACCTGTCGGTCGA
GGCCAGCCGGGCGACGCTGCTGTACCTGAGCATGACGGCGCACCGTCTCATCAGCGAGGGCTTCTGGGTCTTCAT
CTTCTATCCCATGTCGGCCGTTGTCACGCTGTTCTTTCACGTGCTGCGCGACCCTAGCGACGCCCAGGCGGCGGC
TGACGTGAGGCTGCTCTCGCAGGCGTCGGACGTGATCAAGACGATGCCCGTGGGAAGCATCACGGCGAGGGAGAG
GGCCTATCTGCTCGAGGTGGATGGGTTCGTGGCGGAACTTGGAGGGTTGGCGCGGTGTGCGGTTGCGAGGGGGTG
AATCCCAGGGGTGAGGGGAGGGTGAGCTCGGACTGGACTGGACTGGACTGGGCTGGGCTGGGCTGGGCTGGGGTC
ACTCTGCTTGGATATTGGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail