Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04614
Gene name
Locationscaffold_04:3704455..3704765
Strand-
Gene length (bp)310
Transcript length (bp)207
Coding sequence length (bp)207
Protein length (aa) 69

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09072 TMA7 Translation machinery associated TMA7 5.0E-26 5 68

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4574 0.6364 0.0379 0.1694 0.0566 0.0005 0.202 0.0118 0.0836 0.0007

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1595
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7992
Ophiocordyceps australis map64 (Brazil) OphauB2|2387
Ophiocordyceps camponoti-floridani Ophcf2|04614 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3403
Ophiocordyceps kimflemingae Ophio5|2759
Ophiocordyceps subramaniannii Hirsu2|1232

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04614
MGGSNREGGKAKPLKQPKKADKDLDDDDKAFHEKKRAEEKARKEMAAKAGGKGPLNTGSQGIKKSGKK*
Coding >Ophcf2|04614
ATGGGAGGCTCCAACCGAGAAGGCGGCAAAGCCAAGCCGCTGAAACAGCCGAAAAAGGCAGACAAGGACCTCGAC
GACGACGACAAGGCCTTTCACGAGAAGAAGCGCGCAGAGGAGAAGGCGCGCAAGGAGATGGCAGCCAAGGCCGGC
GGCAAGGGGCCTCTCAACACGGGGTCGCAGGGCATTAAGAAGAGCGGCAAGAAATAG
Transcript >Ophcf2|04614
ATGGGAGGCTCCAACCGAGAAGGCGGCAAAGCCAAGCCGCTGAAACAGCCGAAAAAGGCAGACAAGGACCTCGAC
GACGACGACAAGGCCTTTCACGAGAAGAAGCGCGCAGAGGAGAAGGCGCGCAAGGAGATGGCAGCCAAGGCCGGC
GGCAAGGGGCCTCTCAACACGGGGTCGCAGGGCATTAAGAAGAGCGGCAAGAAATAG
Gene >Ophcf2|04614
ATGGGAGGCTCCAACCGAGAAGGCAAACCCCCCCCCCCCCCAAAACTCCAGGCCCCTTACTGACGAAACCAGGCG
GCAAAGCCAAGCCGCTGAAACAGCCGAAAAAGGCAGACAAGGACCTCGACGACGACGACAAGGCCTTTCACGAGA
AGAAGCGCGCAGGTATGACGAGGCCACGCCGTCAAGTACGACTCCGCTGACTGCAGGCCACGCAGAGGAGAAGGC
GCGCAAGGAGATGGCAGCCAAGGCCGGCGGCAAGGGGCCTCTCAACACGGGGTCGCAGGGCATTAAGAAGAGCGG
CAAGAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail