Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04608
Gene name
Locationscaffold_04:3691380..3692031
Strand-
Gene length (bp)651
Transcript length (bp)525
Coding sequence length (bp)525
Protein length (aa) 175

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 3.4E-14 79 163

GO

GO Term Description Terminal node
GO:0008324 cation transmembrane transporter activity Yes
GO:0006812 cation transport Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006811 ion transport No
GO:0006810 transport No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0015075 ion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0051179 localization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum|Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1339 0.124 0.1651 0.0873 0.1849 0.0842 0.739 0.6609 0.5348 0.4714

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 72 94 22
2 104 123 19
3 144 166 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup260
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7911
Ophiocordyceps australis map64 (Brazil) OphauB2|4252
Ophiocordyceps camponoti-floridani Ophcf2|04607
Ophiocordyceps camponoti-floridani Ophcf2|04608 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06095
Ophiocordyceps camponoti-rufipedis Ophun1|2880
Ophiocordyceps camponoti-rufipedis Ophun1|3880
Ophiocordyceps kimflemingae Ophio5|223
Ophiocordyceps kimflemingae Ophio5|7004
Ophiocordyceps subramaniannii Hirsu2|10352

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04608
MPPDDTPQPPPPTLLDPRLLLQAKSGPDALSNRQRPVRRFYSQQNRLIDQYLGAEDEERAAEDEELRLRPRVRFA
VYGSFAVNGGLFVIQLYAAVKTGSLSLFATAADAFMDLISSCIMVVTSRLARRPSIYRFPVGRTRIEPVGIIVFC
ALMATVAVELMVGHFLSRFVWARS*
Coding >Ophcf2|04608
ATGCCCCCCGACGACACGCCACAGCCACCACCTCCCACGCTCCTAGACCCACGCCTCCTCCTGCAAGCAAAGTCC
GGCCCCGACGCCCTAAGCAACCGCCAACGTCCCGTCCGACGCTTCTACTCGCAGCAGAACCGGCTGATCGACCAG
TACCTGGGCGCCGAGGACGAGGAGCGGGCGGCGGAGGACGAGGAGCTTCGATTGAGGCCGCGCGTGCGCTTCGCT
GTTTACGGCTCGTTCGCTGTGAATGGCGGCTTGTTCGTTATACAGCTCTACGCGGCTGTCAAGACGGGGTCGTTG
TCGTTGTTTGCTACGGCGGCGGATGCGTTTATGGATCTCATCTCGTCTTGTATTATGGTGGTCACCTCGCGGCTT
GCGCGTCGGCCAAGCATTTATCGCTTTCCGGTGGGCCGGACGCGCATCGAGCCCGTTGGAATCATTGTATTTTGT
GCCTTGATGGCGACTGTGGCTGTCGAGCTCATGGTAGGTCATTTTCTGTCTCGATTTGTCTGGGCTCGTTCTTGA
Transcript >Ophcf2|04608
ATGCCCCCCGACGACACGCCACAGCCACCACCTCCCACGCTCCTAGACCCACGCCTCCTCCTGCAAGCAAAGTCC
GGCCCCGACGCCCTAAGCAACCGCCAACGTCCCGTCCGACGCTTCTACTCGCAGCAGAACCGGCTGATCGACCAG
TACCTGGGCGCCGAGGACGAGGAGCGGGCGGCGGAGGACGAGGAGCTTCGATTGAGGCCGCGCGTGCGCTTCGCT
GTTTACGGCTCGTTCGCTGTGAATGGCGGCTTGTTCGTTATACAGCTCTACGCGGCTGTCAAGACGGGGTCGTTG
TCGTTGTTTGCTACGGCGGCGGATGCGTTTATGGATCTCATCTCGTCTTGTATTATGGTGGTCACCTCGCGGCTT
GCGCGTCGGCCAAGCATTTATCGCTTTCCGGTGGGCCGGACGCGCATCGAGCCCGTTGGAATCATTGTATTTTGT
GCCTTGATGGCGACTGTGGCTGTCGAGCTCATGGTAGGTCATTTTCTGTCTCGATTTGTCTGGGCTCGTTCTTGA
Gene >Ophcf2|04608
ATGCCCCCCGACGACACGCCACAGCCACCACCTCCCACGCTCCTAGACCCACGCCTCCTCCTGCAAGCAAAGTCC
GGCCCCGACGCCCTAAGCAACCGCCAACGTCCCGTCCGACGCTTCTACTCGCAGCAGAACCGGCTGATCGACCAG
TACCTGGGCGCCGAGGACGAGGAGCGGGCGGCGGAGGACGAGGAGCTTCGATTGAGGCCGCGCGTGCGCTTCGCT
GTTTACGGCTCGTTCGCTGTGAATGGCGGCTTGTTCGTTATACAGCTCTACGCGGCTGTCAAGACGGGGTCGTTG
TCGGTGGGTTATGTGGTAGTTCAAAGTGATGATTTCGCTGCTGACCTTTTTTTTCTTTTCTTTTTACTCTCTCTT
GTAGTTGTTTGCTACGGCGGCGGATGCGTTTATGGATCTCATCTCGTCTTGTATTATGGTGGTCACCTCGCGGCT
TGCGCGTCGGCCAAGCATTTATCGCTTTCCGGTGGTGAGTTTGGCCGTCTTGGATACGAATCATGGCTTGTTCTG
ACTCTATAGGGCCGGACGCGCATCGAGCCCGTTGGAATCATTGTATTTTGTGCCTTGATGGCGACTGTGGCTGTC
GAGCTCATGGTAGGTCATTTTCTGTCTCGATTTGTCTGGGCTCGTTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail