Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04607
Gene name
Locationscaffold_04:3690258..3690863
Strand-
Gene length (bp)605
Transcript length (bp)558
Coding sequence length (bp)558
Protein length (aa) 186

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16916 ZT_dimer Dimerisation domain of Zinc Transporter 2.0E-07 90 152

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Signal peptide|Transmembrane domain 0.2607 0.1705 0.3129 0.6632 0.2372 0.0768 0.4304 0.4391 0.5011 0.0285

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 40 62 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup260
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7911
Ophiocordyceps australis map64 (Brazil) OphauB2|4252
Ophiocordyceps camponoti-floridani Ophcf2|04607 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04608
Ophiocordyceps camponoti-floridani Ophcf2|06095
Ophiocordyceps camponoti-rufipedis Ophun1|2880
Ophiocordyceps camponoti-rufipedis Ophun1|3880
Ophiocordyceps kimflemingae Ophio5|223
Ophiocordyceps kimflemingae Ophio5|7004
Ophiocordyceps subramaniannii Hirsu2|10352

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04607
MIYCFFYRRFPSVHVFFVDHRNDIVVNVFGLVMSIVGDRFVWYLDPVGAICIALLILVSWSANAFEQAGLLAGRS
APTAYISKLIYVSLTHSSHILKVDTCRAYHAGQNYYVEIDVVMDAETPLLVSHDVGQSLQRKLEGLADVERAFVH
IDYEHEHDIYEEHKPLYDKTEPKSFREQIRSCLSN*
Coding >Ophcf2|04607
ATGATATACTGCTTCTTCTACCGGCGTTTCCCCTCCGTCCACGTCTTCTTCGTCGACCACCGCAACGACATCGTC
GTCAACGTCTTCGGCCTCGTCATGTCCATCGTCGGCGACCGCTTCGTCTGGTATCTCGATCCCGTCGGCGCCATC
TGCATCGCCCTCCTCATCCTCGTCTCTTGGTCTGCCAACGCGTTCGAGCAGGCTGGGCTGCTGGCCGGCAGAAGC
GCGCCAACAGCCTACATCTCCAAGCTCATCTACGTATCCCTGACGCACAGCAGTCACATACTCAAGGTCGACACT
TGCCGAGCCTATCACGCCGGTCAAAACTATTACGTCGAGATTGACGTCGTCATGGACGCCGAGACGCCCCTTCTT
GTCTCGCACGATGTCGGCCAGTCGCTGCAGCGTAAGCTCGAGGGCCTGGCCGACGTAGAGAGGGCCTTTGTCCAT
ATCGACTACGAGCACGAGCATGACATTTATGAGGAACACAAGCCTCTCTACGACAAGACGGAGCCCAAGAGCTTC
CGCGAGCAGATTCGATCCTGTCTATCGAATTGA
Transcript >Ophcf2|04607
ATGATATACTGCTTCTTCTACCGGCGTTTCCCCTCCGTCCACGTCTTCTTCGTCGACCACCGCAACGACATCGTC
GTCAACGTCTTCGGCCTCGTCATGTCCATCGTCGGCGACCGCTTCGTCTGGTATCTCGATCCCGTCGGCGCCATC
TGCATCGCCCTCCTCATCCTCGTCTCTTGGTCTGCCAACGCGTTCGAGCAGGCTGGGCTGCTGGCCGGCAGAAGC
GCGCCAACAGCCTACATCTCCAAGCTCATCTACGTATCCCTGACGCACAGCAGTCACATACTCAAGGTCGACACT
TGCCGAGCCTATCACGCCGGTCAAAACTATTACGTCGAGATTGACGTCGTCATGGACGCCGAGACGCCCCTTCTT
GTCTCGCACGATGTCGGCCAGTCGCTGCAGCGTAAGCTCGAGGGCCTGGCCGACGTAGAGAGGGCCTTTGTCCAT
ATCGACTACGAGCACGAGCATGACATTTATGAGGAACACAAGCCTCTCTACGACAAGACGGAGCCCAAGAGCTTC
CGCGAGCAGATTCGATCCTGTCTATCGAATTGA
Gene >Ophcf2|04607
ATGATATACTGCTTCTTCTACCGGCGTTTCCCCTCCGTCCACGTCTTCTTCGTCGACCACCGCAACGACATCGTC
GTCAACGTCTTCGGCCTCGTCATGTCCATCGTCGGCGACCGCTTCGTCTGGTATCTCGATCCCGTCGGCGCCATC
TGCATCGCCCTCCTCATCCTCGTCTCTTGGTCTGCCAACGCGTTCGAGCAGGCTGGGCTGCTGGCCGGCAGAAGC
GCGCCAACAGCCTACATCTCCAAGCTCATCTACGTATCCCTGACGCACAGCAGTCACATACTCAAGGTCGACACT
GTCAGTATCAGCTCGTCTGCTCGTCTCTCCTGATGCTGACGATGTAGTGCCGAGCCTATCACGCCGGTCAAAACT
ATTACGTCGAGATTGACGTCGTCATGGACGCCGAGACGCCCCTTCTTGTCTCGCACGATGTCGGCCAGTCGCTGC
AGCGTAAGCTCGAGGGCCTGGCCGACGTAGAGAGGGCCTTTGTCCATATCGACTACGAGCACGAGCATGACATTT
ATGAGGAACACAAGCCTCTCTACGACAAGACGGAGCCCAAGAGCTTCCGCGAGCAGATTCGATCCTGTCTATCGA
ATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail