Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04606
Gene name
Locationscaffold_04:3687826..3689215
Strand-
Gene length (bp)1389
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02655 ATP-grasp_3 ATP-grasp domain 1.0E-11 182 363

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0046872 metal ion binding Yes
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.7143 0.5402 0.1405 0.0245 0.2023 0.0753 0.091 0.1196 0.0629 0.0661

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup787
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1675
Ophiocordyceps australis map64 (Brazil) OphauB2|3459
Ophiocordyceps camponoti-floridani Ophcf2|04605
Ophiocordyceps camponoti-floridani Ophcf2|04606 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2881
Ophiocordyceps kimflemingae Ophio5|7007
Ophiocordyceps subramaniannii Hirsu2|3073

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04606
MAPPIIEFDATLKDLYQLDSGKLYANFTHPFGQVQYSRGLPTSSKYTFQDPRNNSENVEAARIFIHVVAQFFTMV
AGAINVVMFDIDMPGLTQGPDLQARADTEAVLGQIARQQKPYVKHVQKSSEILLPPDAIISSVGPIDCLEHLPSL
VSFDAHYRALSKRELALSGVPTPRTDVIDTILDALQVQDPQLRAAEVRRMLEPVEQKPVPFVVKLPQSSAGRGTF
IVRNQHDRYETVNELGVEVDRMLCKLTDANTHLRPVCLLVQEMVAGSALAISMFVSKAGDALVTSCCDQEIGPQG
SYSGGHIDYSQQPRLKDEYTPIANQVAAYMHRLGYHGPIGFDAMTGPQGEHLVIDMNARVTGSFALGLLKGFFRT
ARGFNNVSVMIQMSLIIGLDEFRSRFSDEIDEGRLVIGGWCRKTTRKSCMAVILVAGEEQESMVALAKRIKALDK
PDPSDEPLNEDI*
Coding >Ophcf2|04606
ATGGCACCCCCAATCATCGAGTTCGATGCCACCCTCAAAGACCTCTACCAGCTCGACTCCGGGAAACTCTACGCC
AACTTCACACATCCGTTCGGTCAAGTGCAGTATAGCCGCGGCCTTCCCACCTCCAGCAAATACACCTTCCAGGAC
CCCCGAAACAACTCAGAAAACGTCGAGGCGGCCCGCATCTTTATACACGTCGTCGCCCAGTTCTTCACCATGGTG
GCTGGCGCCATCAATGTCGTCATGTTCGATATCGACATGCCCGGCCTGACTCAAGGCCCAGATCTCCAAGCCCGA
GCCGATACTGAGGCCGTGCTGGGCCAGATTGCCCGACAGCAAAAGCCCTACGTGAAGCACGTGCAGAAGTCGTCG
GAGATTTTGCTCCCTCCTGACGCTATCATCTCCAGTGTTGGCCCAATTGACTGTTTGGAGCATCTCCCCAGCCTG
GTATCGTTCGACGCCCACTATCGAGCGCTCTCCAAGCGAGAGCTGGCCCTGTCCGGCGTGCCAACACCGCGGACC
GACGTCATCGACACCATCCTCGACGCCCTCCAGGTCCAGGACCCGCAACTCAGGGCAGCAGAGGTCAGACGCATG
CTGGAGCCTGTCGAACAGAAGCCAGTTCCGTTCGTCGTCAAGCTCCCCCAGAGCTCTGCCGGACGAGGAACCTTT
ATCGTGCGAAATCAACATGATCGGTATGAGACGGTTAACGAACTCGGCGTAGAAGTCGACAGGATGCTATGTAAG
CTCACCGATGCAAACACTCACCTGCGGCCAGTCTGCCTCCTCGTTCAGGAAATGGTCGCTGGCTCAGCCCTAGCG
ATATCCATGTTCGTCTCCAAAGCGGGAGACGCGCTCGTGACATCCTGCTGCGACCAGGAAATCGGACCCCAAGGA
AGCTACAGCGGCGGTCACATCGACTATTCACAGCAGCCGCGCCTCAAGGATGAGTACACACCTATCGCGAACCAG
GTCGCTGCCTACATGCATAGGCTCGGATACCACGGCCCGATAGGCTTCGACGCCATGACAGGTCCCCAAGGAGAG
CATCTAGTCATCGACATGAACGCGCGGGTGACGGGTTCATTTGCGCTTGGCCTCTTGAAGGGCTTCTTCCGCACA
GCACGCGGCTTCAACAACGTATCCGTCATGATACAAATGAGCCTGATCATCGGGCTGGACGAATTCAGGAGCAGG
TTCAGCGACGAGATAGATGAGGGAAGACTTGTCATTGGTGGCTGGTGTCGCAAGACGACGCGCAAGAGCTGCATG
GCGGTGATCTTGGTCGCCGGAGAAGAACAAGAGAGTATGGTAGCTCTTGCGAAGCGAATCAAGGCACTGGATAAG
CCTGATCCATCAGATGAGCCACTTAACGAGGATATCTGA
Transcript >Ophcf2|04606
ATGGCACCCCCAATCATCGAGTTCGATGCCACCCTCAAAGACCTCTACCAGCTCGACTCCGGGAAACTCTACGCC
AACTTCACACATCCGTTCGGTCAAGTGCAGTATAGCCGCGGCCTTCCCACCTCCAGCAAATACACCTTCCAGGAC
CCCCGAAACAACTCAGAAAACGTCGAGGCGGCCCGCATCTTTATACACGTCGTCGCCCAGTTCTTCACCATGGTG
GCTGGCGCCATCAATGTCGTCATGTTCGATATCGACATGCCCGGCCTGACTCAAGGCCCAGATCTCCAAGCCCGA
GCCGATACTGAGGCCGTGCTGGGCCAGATTGCCCGACAGCAAAAGCCCTACGTGAAGCACGTGCAGAAGTCGTCG
GAGATTTTGCTCCCTCCTGACGCTATCATCTCCAGTGTTGGCCCAATTGACTGTTTGGAGCATCTCCCCAGCCTG
GTATCGTTCGACGCCCACTATCGAGCGCTCTCCAAGCGAGAGCTGGCCCTGTCCGGCGTGCCAACACCGCGGACC
GACGTCATCGACACCATCCTCGACGCCCTCCAGGTCCAGGACCCGCAACTCAGGGCAGCAGAGGTCAGACGCATG
CTGGAGCCTGTCGAACAGAAGCCAGTTCCGTTCGTCGTCAAGCTCCCCCAGAGCTCTGCCGGACGAGGAACCTTT
ATCGTGCGAAATCAACATGATCGGTATGAGACGGTTAACGAACTCGGCGTAGAAGTCGACAGGATGCTATGTAAG
CTCACCGATGCAAACACTCACCTGCGGCCAGTCTGCCTCCTCGTTCAGGAAATGGTCGCTGGCTCAGCCCTAGCG
ATATCCATGTTCGTCTCCAAAGCGGGAGACGCGCTCGTGACATCCTGCTGCGACCAGGAAATCGGACCCCAAGGA
AGCTACAGCGGCGGTCACATCGACTATTCACAGCAGCCGCGCCTCAAGGATGAGTACACACCTATCGCGAACCAG
GTCGCTGCCTACATGCATAGGCTCGGATACCACGGCCCGATAGGCTTCGACGCCATGACAGGTCCCCAAGGAGAG
CATCTAGTCATCGACATGAACGCGCGGGTGACGGGTTCATTTGCGCTTGGCCTCTTGAAGGGCTTCTTCCGCACA
GCACGCGGCTTCAACAACGTATCCGTCATGATACAAATGAGCCTGATCATCGGGCTGGACGAATTCAGGAGCAGG
TTCAGCGACGAGATAGATGAGGGAAGACTTGTCATTGGTGGCTGGTGTCGCAAGACGACGCGCAAGAGCTGCATG
GCGGTGATCTTGGTCGCCGGAGAAGAACAAGAGAGTATGGTAGCTCTTGCGAAGCGAATCAAGGCACTGGATAAG
CCTGATCCATCAGATGAGCCACTTAACGAGGATATCTGA
Gene >Ophcf2|04606
ATGGCACCCCCAATCATCGAGTTCGATGCCACCCTCAAAGACCTCTACCAGCTCGACTCCGGGAAACTCTACGCC
AACTTCACACATCCGTTCGGTCAAGTGCAGTATAGCCGCGGCCTTCCCACCTCCAGCAAATACACCTTCCAGGAC
CCCCGAAACAACTCAGAAAACGTCGAGGCGGCCCGCATCTTTATACACGTCGTCGCCCAGTTCTTCACCATGGTG
GCTGGCGCCATCAATGTCGTCATGTTCGATATCGACATGCCCGGCCTGACTCAAGGCCCAGATCTCCAAGCCCGA
GCCGATACTGAGGCCGTGCTGGGCCAGATTGCCCGACAGCAAAAGCCCTACGTGAAGCACGTGCAGAAGTCGTCG
GAGATTTTGCTCCCTCCTGACGCTATCATCTCCAGTGTTGGCCCAATTGACTGTTTGGAGCATCTCCCCAGCCTG
GTATCGTTCGACGCCCACTATCGAGCGCTCTCCAAGCGAGAGCTGGCCCTGTCCGGCGTGCCAACACCGCGGACC
GACGTCATCGACACCATCCTCGACGCCCTCCAGGTCCAGGACCCGCAACTCAGGGCAGCAGAGGTCAGACGCATG
CTGGAGCCTGTCGAACAGAAGCCAGTTCCGTTCGTCGTCAAGCTCCCCCAGAGCTCTGCCGGACGAGGAACCTTT
ATCGTGCGAAATCAACATGATCGGTATGAGACGGTTAACGAACTCGGCGTAGAAGTCGACAGGATGCTATGTAAG
CTCACCGATGCAAACACTCACCTGCGGCCAGTCTGCCTCCTCGTTCAGGAAATGGTCGCTGGCTCAGCCCTAGCG
ATATCCATGTTCGTCTCCAAAGCGGGAGACGCGCTCGTGACATCCTGCTGCGACCAGGAAATCGGACCCCAAGGA
AGCTACAGCGGCGGTCACATCGACTATTCACAGCAGCCGCGCCTCAAGGATGAGTACACACCTATCGCGAACCAG
GTCGCTGCCTACATGCATAGGCTCGGATACCACGGCCCGATAGGCTTCGACGCCATGACAGGTCCCCAAGGAGAG
CATCTAGTCATCGACATGAACGCGCGGGTGACGGGTTCATTTGCGCTTGGCCTCTTGAAGGGCTTCTTCCGCACA
GCACGCGGCTTCAACAACGTATCCGTCATGATACAAATGAGCCTGATCATCGGGCTGGACGAATTCAGGAGCAGG
TTCAGCGACGAGATAGATGAGGGAAGACTTGTCATTGGTGGCTGGTGTCGCAAGACGACGCGCAAGAGCTGCATG
GCGGTGATCTTGGTCGCCGGAGAAGAACAAGAGAGTATGGTAGCTCTTGCGAAGCGAATCAAGGCACTGGATAAG
CCTGATCCATCAGATGAGCCACTTAACGAGGATATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail