Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04603
Gene name
Locationscaffold_04:3683632..3684840
Strand-
Gene length (bp)1208
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03403 PAF-AH_p_II Platelet-activating factor acetylhydrolase, isoform II 1.0E-12 99 167
PF03403 PAF-AH_p_II Platelet-activating factor acetylhydrolase, isoform II 7.7E-07 221 325
PF12740 Chlorophyllase2 Chlorophyllase enzyme 1.3E-07 124 244

GO

GO Term Description Terminal node
GO:0016042 lipid catabolic process Yes
GO:0003847 1-alkyl-2-acetylglycerophosphocholine esterase activity Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0052689 carboxylic ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:1901575 organic substance catabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0006629 lipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 15.70 6.65 24.74
Alive In ants, during behavior modification 116.80 59.88 173.72
Dead In ants, recently dead 76.04 40.71 111.36

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.012703 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04603
MLSPLLLAAALVAVVRAILVPGPIGAFPVAMRTHELIDFSRVDPYASRNHTLLRRILVSVFLPLDPVQYADAKVQ
QLPYMPPLTAAEYSRITQIIAPSFKGVFEKLAIEYRRLETNDPGREYATKKKSYPVVIFSPGLGASRLMYSAGAR
DLASQGYIVITIDHPYDASIVEFPDGSVVRGVNFSTTAQIAVAAKVRVQDVVFLVNQLHDSDVQERLTEGFPGLV
NVEKMAIYGHSLGGATAAEALRKDSRLLGGMNWDGEMQEAAASHGLAQPFIQVGVPRHRYENNSNWPAFYEKLRG
PKLELMLENTTHISFTDLPLLLSTMEVPLEAQPSLEYFLGTVSGRRLRRTLTGILKASLEFLFERNVEGVRSLAE
DYCGVTVF*
Coding >Ophcf2|04603
ATGCTTTCGCCTCTTCTTCTCGCCGCTGCCCTCGTGGCCGTCGTCCGGGCCATCTTGGTACCAGGGCCGATTGGG
GCGTTTCCTGTGGCGATGCGAACCCACGAGCTCATCGATTTCAGCCGGGTTGATCCCTATGCGTCTCGCAATCAC
ACTCTCCTGAGAAGAATTCTCGTCTCCGTCTTCCTGCCTCTCGACCCGGTCCAATACGCGGATGCCAAGGTCCAG
CAGCTGCCTTATATGCCACCTCTTACGGCGGCCGAGTACAGCCGAATTACCCAGATCATCGCGCCCTCGTTCAAG
GGCGTTTTTGAGAAACTGGCGATTGAATATCGACGGCTGGAGACGAACGATCCGGGTCGAGAGTATGCGACGAAA
AAGAAGAGCTACCCGGTTGTCATCTTCTCGCCCGGACTAGGCGCGTCCAGGTTGATGTACTCTGCCGGTGCCAGG
GATCTGGCCAGTCAGGGCTACATCGTCATCACCATAGATCATCCTTACGACGCGTCCATTGTCGAATTTCCCGAC
GGCTCCGTCGTTCGCGGCGTCAACTTCTCGACGACGGCTCAAATTGCCGTCGCCGCCAAGGTTCGCGTGCAAGAC
GTCGTATTCCTTGTGAACCAGCTGCACGACTCCGATGTCCAAGAGCGGCTCACGGAAGGCTTTCCCGGCCTCGTC
AACGTGGAAAAGATGGCCATCTACGGCCACTCGCTGGGCGGCGCGACGGCAGCCGAAGCCTTGCGGAAGGACAGC
CGGCTCCTCGGCGGCATGAACTGGGACGGAGAGATGCAGGAAGCAGCGGCAAGCCACGGACTCGCTCAGCCCTTC
ATCCAGGTCGGCGTCCCGAGACATCGCTACGAAAACAACTCCAACTGGCCGGCCTTTTACGAGAAGCTACGCGGA
CCCAAGCTGGAGCTGATGTTGGAGAATACGACACACATTTCGTTCACGGACCTGCCGCTACTGCTGTCGACGATG
GAGGTTCCGCTCGAGGCGCAGCCTTCGCTAGAGTACTTCTTGGGGACTGTCAGTGGACGGCGGCTGAGGCGGACG
TTGACGGGGATCCTGAAAGCGTCGTTGGAGTTTTTGTTTGAGAGGAATGTGGAGGGCGTGAGGAGTTTGGCTGAG
GATTATTGCGGGGTGACGGTTTTTTAG
Transcript >Ophcf2|04603
ATGCTTTCGCCTCTTCTTCTCGCCGCTGCCCTCGTGGCCGTCGTCCGGGCCATCTTGGTACCAGGGCCGATTGGG
GCGTTTCCTGTGGCGATGCGAACCCACGAGCTCATCGATTTCAGCCGGGTTGATCCCTATGCGTCTCGCAATCAC
ACTCTCCTGAGAAGAATTCTCGTCTCCGTCTTCCTGCCTCTCGACCCGGTCCAATACGCGGATGCCAAGGTCCAG
CAGCTGCCTTATATGCCACCTCTTACGGCGGCCGAGTACAGCCGAATTACCCAGATCATCGCGCCCTCGTTCAAG
GGCGTTTTTGAGAAACTGGCGATTGAATATCGACGGCTGGAGACGAACGATCCGGGTCGAGAGTATGCGACGAAA
AAGAAGAGCTACCCGGTTGTCATCTTCTCGCCCGGACTAGGCGCGTCCAGGTTGATGTACTCTGCCGGTGCCAGG
GATCTGGCCAGTCAGGGCTACATCGTCATCACCATAGATCATCCTTACGACGCGTCCATTGTCGAATTTCCCGAC
GGCTCCGTCGTTCGCGGCGTCAACTTCTCGACGACGGCTCAAATTGCCGTCGCCGCCAAGGTTCGCGTGCAAGAC
GTCGTATTCCTTGTGAACCAGCTGCACGACTCCGATGTCCAAGAGCGGCTCACGGAAGGCTTTCCCGGCCTCGTC
AACGTGGAAAAGATGGCCATCTACGGCCACTCGCTGGGCGGCGCGACGGCAGCCGAAGCCTTGCGGAAGGACAGC
CGGCTCCTCGGCGGCATGAACTGGGACGGAGAGATGCAGGAAGCAGCGGCAAGCCACGGACTCGCTCAGCCCTTC
ATCCAGGTCGGCGTCCCGAGACATCGCTACGAAAACAACTCCAACTGGCCGGCCTTTTACGAGAAGCTACGCGGA
CCCAAGCTGGAGCTGATGTTGGAGAATACGACACACATTTCGTTCACGGACCTGCCGCTACTGCTGTCGACGATG
GAGGTTCCGCTCGAGGCGCAGCCTTCGCTAGAGTACTTCTTGGGGACTGTCAGTGGACGGCGGCTGAGGCGGACG
TTGACGGGGATCCTGAAAGCGTCGTTGGAGTTTTTGTTTGAGAGGAATGTGGAGGGCGTGAGGAGTTTGGCTGAG
GATTATTGCGGGGTGACGGTTTTTTAG
Gene >Ophcf2|04603
ATGCTTTCGCCTCTTCTTCTCGCCGCTGCCCTCGTGGCCGTCGTCCGGGCCATCTTGGTACCAGGGCCGATTGGG
GCGTTTCCTGTGGCGATGCGAACCCACGAGCTCATCGATTTCAGCCGGGTTGATCCCTATGCGTCTCGCAATCAC
ACTCTCCTGAGAAGAATTCTCGTCTCCGTCTTCCTGCCTCTCGACCCGGTCCAATACGCGGATGCCAAGGTCCAG
CAGCTGCCTTATATGCCACCTCTTACGGCGGCCGAGTACAGCCGAATTACCCAGATCATCGCGCCCTCGTTCAAG
GGCGTTTTTGAGAAACTGGCGATTGAATATCGACGGCTGGAGACGAACGATCCGGGTCGAGAGTATGCGACGAAA
AAGAAGAGCTACCCGGTTGTCATCTTCTCGCCCGGACTAGGCGCGTCCAGGTTGATGTACTCTGCCGGTGCCAGG
GATCTGGCCAGTCAGGGCTACATCGTCATCACCATAGATCATCCTTACGACGCGTCCATTGTCGAATTTCCCGAC
GGCTCCGTCGTTCGCGGCGTCAACTTCTCGACGACGGCTCAAATTGCCGTCGCCGCCAAGGTTGGGCGTGCTCAC
GCGAGTGGATTGATGTCGACGAAGCGGCTGACGGCGTGCAGGTTCGCGTGCAAGACGTCGTATTCCTTGTGAACC
AGCTGCACGACTCCGATGTCCAAGAGCGGCTCACGGAAGGCTTTCCCGGCCTCGTCAACGTGGAAAAGATGGCCA
TCTACGGCCACTCGCTGGGCGGCGCGACGGCAGCCGAAGCCTTGCGGAAGGACAGCCGGCTCCTCGGCGGCATGA
ACTGGGACGGAGAGATGCAGGAAGCAGCGGCAAGCCACGGACTCGCTCAGCCCTTCATCCAGGTCGGCGTCCCGA
GACATCGCTACGAAAACAACTCCAACTGGCCGGCCTTTTACGAGAAGCTACGCGGACCCAAGCTGGAGCTGATGT
TGGAGAATACGACACACATTTCGTTCACGGACCTGCCGCTACTGCTGTCGACGATGGAGGTTCCGCTCGAGGCGC
AGCCTTCGCTAGAGTACTTCTTGGGGACTGTCAGTGGACGGCGGCTGAGGCGGACGTTGACGGGGATCCTGAAAG
CGTCGTTGGAGTTTTTGTTTGAGAGGAATGTGGAGGGCGTGAGGAGTTTGGCTGAGGATTATTGCGGGGTGACGG
TTTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail