Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04600
Gene name
Locationscaffold_04:3676410..3679430
Strand-
Gene length (bp)3020
Transcript length (bp)2820
Coding sequence length (bp)2820
Protein length (aa) 940

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 8.6E-76 390 674
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 1.3E-40 210 379
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 1.3E-35 41 186

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 123 145 22
3 165 187 22
4 395 417 22
5 446 468 22
6 489 511 22
7 601 623 22
8 654 676 22
9 680 702 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04600
MDMPMLSARDDSPNDASKQLLDLLKNPFRGQLADAALPPAIGISLGFTALIAICFSFIRPYNQAIYAPKLKHADE
KHAPPPLGRKPWSWITPLMNTTEASLVPQIGMDATIFLRFTRMCRNMFLVLALVGIAILVPVNVTNTAAYDGQHG
EWSMRITPRGVWGAPQWAQVVVAWLFDLIIIGFLWFNYRSVLRLRRQYFETDEYQNSLHSRTLMLYDIPRQARSD
EGIARIIDKVVPNSSFARTAVARNVKILPELIDEHEHAVRKLEKILSKYLKNPAQLPASRPTCKPSKKDRSFDTY
PRGQKLDAIDYYTQRIRDLEIEIKEVRASVDRRGTMAYGFASYSDMAEAHAIAHACRGSKPEGATVMLAPKPSDI
IWQNMPLSKATRSRRRWINNFWIVVLTILWVGPNAMMAIFLVNLANLGKVWPAFQRSLSRNIKFWGMVQGIASPA
LTSLVYLVLPIIFRRLSVKAGDQTKTGRERHVLAKMYSFFVFNNLIVFSSFSTIWAFVAGVRERTSRGANAWDAI
EKENMAAGVFVALCDNSLFWVTYLLQRQLGAAVDLAQLWPLIQAFFLKKLSSPTPRELIEMTAPPPFDYASYYNY
FLFYVTVTLCFAGIQPLVLLPTAMYFCIDSYLKKYLILYRFVTKTESGGLFWRVIFNRFILATILSNLVVLLTCW
VRGDGTHVQFYAAAPLPLVMMAFKLYCRRAFDDKIRYYSTRLSSKLLHDAQLQKEPRLRSEKLSTKFGHPALYRP
LMTPMVHSKAQNLLPSVYRGRLTDGRDAGGRRRRGRPGQRQRPLGHYVSESHMDFAYYKDRAEFTEQHGGSELYG
RPGTPGTPGTDAETQSLSGRSFSAATATRNRSPLHGENSGSPLYRQDHGGSPLYAHDNGSSAGLVRNAAAAPTGP
PPLGSFGYSGLAQTEESDPGRTSYFRGGSRPLRPAGEGW*
Coding >Ophcf2|04600
ATGGATATGCCCATGCTGTCCGCCCGCGATGACTCGCCCAACGATGCCAGCAAGCAGCTGCTGGACCTGCTCAAG
AATCCCTTCCGGGGACAGCTCGCGGACGCCGCCCTCCCCCCGGCCATAGGCATCTCGCTCGGCTTCACCGCCTTG
ATCGCCATCTGCTTCTCCTTCATCCGGCCCTACAATCAGGCCATCTACGCACCCAAGCTCAAGCACGCCGACGAA
AAACATGCGCCGCCTCCCCTCGGCAGGAAGCCTTGGTCGTGGATAACGCCCCTGATGAATACGACAGAGGCATCG
CTCGTCCCCCAGATCGGCATGGACGCCACCATCTTCCTGCGCTTCACCCGCATGTGCCGCAACATGTTTCTCGTT
CTCGCCCTCGTCGGCATCGCCATCCTCGTGCCCGTCAACGTGACCAATACCGCCGCCTACGACGGCCAACACGGC
GAGTGGAGCATGCGAATCACGCCCCGTGGCGTCTGGGGCGCGCCGCAGTGGGCGCAGGTCGTCGTCGCCTGGCTC
TTCGACTTGATCATCATAGGCTTCCTATGGTTCAATTACCGGAGCGTTCTGCGGCTGCGTCGTCAGTACTTTGAG
ACGGACGAGTATCAGAACAGCCTGCACTCGCGCACCCTCATGCTCTACGATATCCCTCGTCAAGCCCGATCCGAC
GAGGGCATCGCCCGCATCATCGACAAGGTGGTGCCCAATTCGTCCTTTGCCCGCACCGCCGTCGCCCGCAACGTC
AAGATCCTGCCCGAGCTCATCGACGAGCACGAGCATGCGGTCCGCAAGCTTGAGAAGATCCTGTCCAAGTACCTT
AAAAACCCGGCCCAGCTGCCCGCCTCGCGACCGACGTGCAAGCCGTCGAAGAAGGATCGGTCGTTTGACACGTAC
CCGCGCGGCCAGAAGCTCGATGCCATCGACTACTACACGCAGCGCATCCGCGACCTCGAGATCGAGATCAAGGAG
GTCCGGGCCAGCGTCGACCGGCGCGGAACGATGGCCTACGGCTTCGCCAGCTACTCGGACATGGCCGAGGCCCAC
GCCATCGCCCACGCATGCCGCGGCTCCAAGCCAGAGGGCGCGACGGTGATGCTGGCGCCCAAGCCGTCGGACATC
ATCTGGCAGAACATGCCGCTGTCCAAGGCCACGCGCAGCCGCCGGCGATGGATCAACAACTTTTGGATCGTCGTC
CTCACCATCCTCTGGGTCGGCCCCAACGCCATGATGGCCATCTTCCTCGTCAACTTGGCCAACCTCGGAAAGGTC
TGGCCCGCCTTCCAGCGCTCCCTCTCGCGCAACATCAAATTCTGGGGCATGGTTCAGGGCATCGCCTCGCCAGCC
CTCACCTCGCTCGTCTACTTGGTGCTGCCCATCATCTTCCGCCGCCTGTCGGTCAAGGCCGGCGACCAGACCAAG
ACGGGCCGCGAGAGGCACGTGCTGGCCAAGATGTACTCGTTCTTCGTCTTCAACAACCTCATCGTCTTCTCCTCC
TTCAGCACCATCTGGGCCTTCGTCGCCGGCGTCAGGGAGCGCACCAGCCGCGGAGCCAACGCGTGGGACGCCATC
GAGAAGGAGAACATGGCCGCGGGCGTCTTCGTCGCCCTTTGCGACAACAGCCTGTTCTGGGTCACGTACCTGCTT
CAGCGCCAGCTGGGCGCCGCCGTCGACCTGGCCCAGCTGTGGCCCCTGATCCAGGCCTTTTTCCTCAAGAAGCTG
TCGAGCCCGACGCCGCGCGAGCTGATCGAGATGACGGCGCCGCCTCCCTTTGACTACGCCAGCTACTACAACTAC
TTCCTCTTCTACGTGACGGTGACGCTGTGCTTCGCCGGCATCCAGCCCCTCGTGCTGCTGCCCACGGCCATGTAC
TTTTGCATCGACTCGTACCTCAAGAAGTACCTGATCCTCTACCGCTTCGTCACCAAGACGGAATCCGGGGGCCTG
TTCTGGCGCGTCATCTTCAACCGCTTCATCCTGGCCACGATCCTGTCCAACCTGGTGGTGCTGCTGACGTGCTGG
GTCCGCGGCGACGGTACCCACGTGCAGTTCTACGCCGCCGCGCCTCTCCCGCTCGTCATGATGGCCTTTAAGCTG
TACTGCCGCCGCGCCTTCGACGACAAGATCCGCTACTACAGCACCCGCCTGAGCTCCAAGCTGCTGCACGACGCC
CAGCTGCAAAAGGAGCCGCGGCTCCGGAGCGAGAAGCTGTCGACCAAGTTCGGCCACCCGGCGCTGTACAGGCCG
CTCATGACGCCCATGGTGCATTCCAAGGCCCAGAACCTGCTCCCCTCGGTCTACAGGGGACGCCTGACGGACGGG
AGGGACGCCGGGGGGCGTCGGCGGCGGGGACGACCTGGTCAGCGTCAGCGGCCACTCGGACATTACGTGTCCGAG
TCGCACATGGACTTTGCCTACTACAAGGACCGGGCCGAGTTTACCGAGCAGCACGGAGGCAGCGAGCTGTACGGG
AGGCCGGGGACTCCGGGGACGCCGGGGACCGACGCCGAGACGCAGTCGTTGTCGGGGCGGTCCTTTTCGGCGGCG
ACGGCGACGCGCAACCGCAGTCCGCTGCACGGGGAGAACTCGGGGAGCCCGCTGTACCGGCAGGATCACGGAGGG
AGCCCGCTGTACGCGCACGACAACGGCAGCTCGGCGGGTCTTGTGCGCAACGCGGCGGCCGCTCCGACGGGGCCG
CCTCCCCTGGGATCCTTCGGCTACAGCGGGCTGGCGCAGACGGAGGAGTCGGATCCGGGGCGGACGAGCTATTTC
CGGGGGGGGAGTCGGCCGTTGAGGCCTGCGGGTGAGGGGTGGTGA
Transcript >Ophcf2|04600
ATGGATATGCCCATGCTGTCCGCCCGCGATGACTCGCCCAACGATGCCAGCAAGCAGCTGCTGGACCTGCTCAAG
AATCCCTTCCGGGGACAGCTCGCGGACGCCGCCCTCCCCCCGGCCATAGGCATCTCGCTCGGCTTCACCGCCTTG
ATCGCCATCTGCTTCTCCTTCATCCGGCCCTACAATCAGGCCATCTACGCACCCAAGCTCAAGCACGCCGACGAA
AAACATGCGCCGCCTCCCCTCGGCAGGAAGCCTTGGTCGTGGATAACGCCCCTGATGAATACGACAGAGGCATCG
CTCGTCCCCCAGATCGGCATGGACGCCACCATCTTCCTGCGCTTCACCCGCATGTGCCGCAACATGTTTCTCGTT
CTCGCCCTCGTCGGCATCGCCATCCTCGTGCCCGTCAACGTGACCAATACCGCCGCCTACGACGGCCAACACGGC
GAGTGGAGCATGCGAATCACGCCCCGTGGCGTCTGGGGCGCGCCGCAGTGGGCGCAGGTCGTCGTCGCCTGGCTC
TTCGACTTGATCATCATAGGCTTCCTATGGTTCAATTACCGGAGCGTTCTGCGGCTGCGTCGTCAGTACTTTGAG
ACGGACGAGTATCAGAACAGCCTGCACTCGCGCACCCTCATGCTCTACGATATCCCTCGTCAAGCCCGATCCGAC
GAGGGCATCGCCCGCATCATCGACAAGGTGGTGCCCAATTCGTCCTTTGCCCGCACCGCCGTCGCCCGCAACGTC
AAGATCCTGCCCGAGCTCATCGACGAGCACGAGCATGCGGTCCGCAAGCTTGAGAAGATCCTGTCCAAGTACCTT
AAAAACCCGGCCCAGCTGCCCGCCTCGCGACCGACGTGCAAGCCGTCGAAGAAGGATCGGTCGTTTGACACGTAC
CCGCGCGGCCAGAAGCTCGATGCCATCGACTACTACACGCAGCGCATCCGCGACCTCGAGATCGAGATCAAGGAG
GTCCGGGCCAGCGTCGACCGGCGCGGAACGATGGCCTACGGCTTCGCCAGCTACTCGGACATGGCCGAGGCCCAC
GCCATCGCCCACGCATGCCGCGGCTCCAAGCCAGAGGGCGCGACGGTGATGCTGGCGCCCAAGCCGTCGGACATC
ATCTGGCAGAACATGCCGCTGTCCAAGGCCACGCGCAGCCGCCGGCGATGGATCAACAACTTTTGGATCGTCGTC
CTCACCATCCTCTGGGTCGGCCCCAACGCCATGATGGCCATCTTCCTCGTCAACTTGGCCAACCTCGGAAAGGTC
TGGCCCGCCTTCCAGCGCTCCCTCTCGCGCAACATCAAATTCTGGGGCATGGTTCAGGGCATCGCCTCGCCAGCC
CTCACCTCGCTCGTCTACTTGGTGCTGCCCATCATCTTCCGCCGCCTGTCGGTCAAGGCCGGCGACCAGACCAAG
ACGGGCCGCGAGAGGCACGTGCTGGCCAAGATGTACTCGTTCTTCGTCTTCAACAACCTCATCGTCTTCTCCTCC
TTCAGCACCATCTGGGCCTTCGTCGCCGGCGTCAGGGAGCGCACCAGCCGCGGAGCCAACGCGTGGGACGCCATC
GAGAAGGAGAACATGGCCGCGGGCGTCTTCGTCGCCCTTTGCGACAACAGCCTGTTCTGGGTCACGTACCTGCTT
CAGCGCCAGCTGGGCGCCGCCGTCGACCTGGCCCAGCTGTGGCCCCTGATCCAGGCCTTTTTCCTCAAGAAGCTG
TCGAGCCCGACGCCGCGCGAGCTGATCGAGATGACGGCGCCGCCTCCCTTTGACTACGCCAGCTACTACAACTAC
TTCCTCTTCTACGTGACGGTGACGCTGTGCTTCGCCGGCATCCAGCCCCTCGTGCTGCTGCCCACGGCCATGTAC
TTTTGCATCGACTCGTACCTCAAGAAGTACCTGATCCTCTACCGCTTCGTCACCAAGACGGAATCCGGGGGCCTG
TTCTGGCGCGTCATCTTCAACCGCTTCATCCTGGCCACGATCCTGTCCAACCTGGTGGTGCTGCTGACGTGCTGG
GTCCGCGGCGACGGTACCCACGTGCAGTTCTACGCCGCCGCGCCTCTCCCGCTCGTCATGATGGCCTTTAAGCTG
TACTGCCGCCGCGCCTTCGACGACAAGATCCGCTACTACAGCACCCGCCTGAGCTCCAAGCTGCTGCACGACGCC
CAGCTGCAAAAGGAGCCGCGGCTCCGGAGCGAGAAGCTGTCGACCAAGTTCGGCCACCCGGCGCTGTACAGGCCG
CTCATGACGCCCATGGTGCATTCCAAGGCCCAGAACCTGCTCCCCTCGGTCTACAGGGGACGCCTGACGGACGGG
AGGGACGCCGGGGGGCGTCGGCGGCGGGGACGACCTGGTCAGCGTCAGCGGCCACTCGGACATTACGTGTCCGAG
TCGCACATGGACTTTGCCTACTACAAGGACCGGGCCGAGTTTACCGAGCAGCACGGAGGCAGCGAGCTGTACGGG
AGGCCGGGGACTCCGGGGACGCCGGGGACCGACGCCGAGACGCAGTCGTTGTCGGGGCGGTCCTTTTCGGCGGCG
ACGGCGACGCGCAACCGCAGTCCGCTGCACGGGGAGAACTCGGGGAGCCCGCTGTACCGGCAGGATCACGGAGGG
AGCCCGCTGTACGCGCACGACAACGGCAGCTCGGCGGGTCTTGTGCGCAACGCGGCGGCCGCTCCGACGGGGCCG
CCTCCCCTGGGATCCTTCGGCTACAGCGGGCTGGCGCAGACGGAGGAGTCGGATCCGGGGCGGACGAGCTATTTC
CGGGGGGGGAGTCGGCCGTTGAGGCCTGCGGGTGAGGGGTGGTGA
Gene >Ophcf2|04600
ATGGATATGCCCATGCTGTCCGCCCGCGATGACTCGCCCAACGATGCCAGCAAGCAGCTGCTGGACCTGCTCAAG
AATCCCTTCCGGGGACAGGTGAGCTCCTATTACGCTTCATTAAGCTCTGCCTTTGCTCTGACTCGGATCAGCTCG
CGGACGCCGCCCTCCCCCCGGCCATAGGCATCTCGCTCGGCTTCACCGCCTTGATCGCCATCTGCTTCTCCTTCA
TCCGGCCCTACAATCAGGCCATCTACGCACCCAAGCTCAAGCACGCCGACGAAAAACATGCGCCGCCTCCCCTCG
GCAGGAAGCCTTGGTCGTGGATAACGCCCCTGATGAATACGACAGAGGCATCGCTCGTCCCCCAGATCGGCATGG
ACGCCACCATCTTCCTGCGCTTCACCCGCATGTGCCGCAACATGTTTCTCGTTCTCGCCCTCGTCGGCATCGCCA
TCCTCGTGCCCGTCAACGTGACCAATACCGCCGCCTACGACGGCCAACACGGCGAGTGGAGCATGCGAATCACGC
CCCGTGGCGTCTGGGGCGCGCCGCAGTGGGCGCAGGTCGTCGTCGCCTGGCTCTTCGACTTGATCATCATAGGCT
TCCTATGGTTCAATTACCGGAGCGTTCTGCGGCTGCGTCGTCAGTACTTTGAGACGGACGAGTATCAGAACAGCC
TGCACTCGCGCACCCTCATGGTAGGTTTCCGTCTGGCCAGCTGCTCCTCTCTTCAGGCCTCTCCCTCATCCCCAT
ATACTGACGATTGCAACAGCTCTACGATATCCCTCGTCAAGCCCGATCCGACGAGGGCATCGCCCGCATCATCGA
CAAGGTGGTGCCCAATTCGTCCTTTGCCCGCACCGCCGTCGCCCGCAACGTCAAGATCCTGCCCGAGCTCATCGA
CGAGCACGAGCATGCGGTCCGCAAGCTTGAGAAGATCCTGTCCAAGTACCTTAAAAACCCGGCCCAGCTGCCCGC
CTCGCGACCGACGTGCAAGCCGTCGAAGAAGGATCGGTCGTTTGACACGTACCCGCGCGGCCAGAAGCTCGATGC
CATCGACTACTACACGCAGCGCATCCGCGACCTCGAGATCGAGATCAAGGAGGTCCGGGCCAGCGTCGACCGGCG
CGGAACGATGGCCTACGGCTTCGCCAGCTACTCGGACATGGCCGAGGCCCACGCCATCGCCCACGCATGCCGCGG
CTCCAAGCCAGAGGGCGCGACGGTGATGCTGGCGCCCAAGCCGTCGGACATCATCTGGCAGAACATGCCGCTGTC
CAAGGCCACGCGCAGCCGCCGGCGATGGATCAACAACTTTTGGATCGTCGTCCTCACCATCCTCTGGGTCGGCCC
CAACGCCATGATGGCCATCTTCCTCGTCAACTTGGCCAACCTCGGAAAGGTCTGGCCCGCCTTCCAGCGCTCCCT
CTCGCGCAACATCAAATTCTGGGGCATGGTTCAGGGCATCGCCTCGCCAGCCCTCACCTCGCTCGTCTACTTGGT
GCTGCCCATCATCTTCCGCCGCCTGTCGGTCAAGGCCGGCGACCAGACCAAGACGGGCCGCGAGAGGCACGTGCT
GGCCAAGATGTACTCGTTCTTCGTCTTCAACAACCTCATCGTCTTCTCCTCCTTCAGCACCATCTGGGCCTTCGT
CGCCGGCGTCAGGGAGCGCACCAGCCGCGGAGCCAACGCGTGGGACGCCATCGAGAAGGAGAACATGGCCGCGGG
CGTCTTCGTCGCCCTTTGCGACAACAGCCTGTTCTGGGTCACGTACCTGCTTCAGCGCCAGCTGGGCGCCGCCGT
CGACCTGGCCCAGCTGTGGCCCCTGATCCAGGCCTTTTTCCTCAAGAAGCTGTCGAGCCCGACGCCGCGCGAGCT
GATCGAGATGACGGCGCCGCCTCCCTTTGACTACGCCAGCTACTACAACTACTTCCTCTTCTACGTGACGGTGAC
GCTGTGCTTCGCCGGCATCCAGCCCCTCGTGCTGCTGCCCACGGCCATGTACTTTTGCATCGACTCGTACCTCAA
GAAGTACCTGATCCTCTACCGCTTCGTCACCAAGACGGAATCCGGGGGCCTGTTCTGGCGCGTCATCTTCAACCG
CTTCATCCTGGCCACGATCCTGTCCAACCTGGTGGTGCTGCTGACGTGCTGGGTCCGCGGCGACGGTACCCACGT
GCAGTTCTACGCCGCCGCGCCTCTCCCGCTCGTCATGATGGCCTTTAAGCTGTACTGCCGCCGCGCCTTCGACGA
CAAGATCCGCTACTACAGCACCCGCCTGAGCTCCAAGCTGCTGCACGACGCCCAGCTGCAAAAGGAGCCGCGGCT
CCGGAGCGAGAAGCTGTCGACCAAGTTCGGCCACCCGGCGCTGTACAGGCCGCTCATGACGCCCATGGTGCATTC
CAAGGCCCAGAACCTGCTCCCCTCGGTCTACAGGGGACGCCTGACGGACGGGAGGGACGCCGGGGGGCGTCGGCG
GCGGGGACGACCTGGTCAGCGTCAGCGGCCACTCGGACATGTACGCCCTCGACGCCATGCAGCAGGGCGGGAGGC
CGGGGAAGAGGGACAGGGGACGGCTGCCGGGCTTCGAGTACGTGTCCGAGTCGCACATGGACTTTGCCTACTACA
AGGACCGGGCCGAGTTTACCGAGCAGCACGGAGGCAGCGAGCTGTACGGGAGGCCGGGGACTCCGGGGACGCCGG
GGACCGACGCCGAGACGCAGTCGTTGTCGGGGCGGTCCTTTTCGGCGGCGACGGCGACGCGCAACCGCAGTCCGC
TGCACGGGGAGAACTCGGGGAGCCCGCTGTACCGGCAGGATCACGGAGGGAGCCCGCTGTACGCGCACGACAACG
GCAGCTCGGCGGGTCTTGTGCGCAACGCGGCGGCCGCTCCGACGGGGCCGCCTCCCCTGGGATCCTTCGGCTACA
GCGGGCTGGCGCAGACGGAGGAGTCGGATCCGGGGCGGACGAGCTATTTCCGGGGGGGGAGTCGGCCGTTGAGGC
CTGCGGGTGAGGGGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail