Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04593
Gene name
Locationscaffold_04:3662099..3664721
Strand+
Gene length (bp)2622
Transcript length (bp)2622
Coding sequence length (bp)2622
Protein length (aa) 874

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 3.0E-22 550 680
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 1.6E-11 727 777

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6342 0.2614 0.0812 0.4056 0.1017 0.0058 0.194 0.2807 0.2257 0.0194

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4286
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7288
Ophiocordyceps australis map64 (Brazil) OphauB2|2393
Ophiocordyceps camponoti-floridani Ophcf2|04593 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7046
Ophiocordyceps kimflemingae Ophio5|8521
Ophiocordyceps subramaniannii Hirsu2|8759

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04593
MYSMAVSHLDTGASIDRQRSISNRQCSVYASRLRPSLSPIDTAEQAMQLPQLPPLPVSPRWDSLSNGTHLILSSP
SDDEASLAERRGRAAPELLLKTSVENFSRPRKQSLRQPSEQSNPVPRLLATTPTDLYDLCASTPHTPPPWQRPRR
RPSASSFKSASPFSSPLGPPPSVDLPVPKPGRARNAAGPPLTTAARAPLATSPMAAGGGAAPWMSDERLRSSFRS
QLTESSAFGTTERSSVLTKDSSITSLYTDEPSVEDVMCMYEKGFADDDDDDDDHHHREKQEGRRGEGQRGGRHNH
LAGDDEGDGDDDADDDEDDDEDDFDIDGDSDGFHRNASVVTATLKDAARPLTAMSEPAADAYLAPPATRSALDAE
IRRSKMLFVSPAFTASVPALSGAADLDVTTEKRDSGKSLDSAPSMTSSGPPLPPPTTEPTPPRTSPTSLFRAAME
PEDPGSRDRYGFKKQNQSVTREQYDAWNKDYTPYLARRRKKWAAYLKECGLMTDRPMRFPPPNGKTKRFVRKGIP
PDWRGAAWFYYAGGPAILAQHSGLYEKLLQREAKPVDVEAIERDLHRTFPDNVQFQPSPGSDAATEPPIISSLRR
VLHAFAVYNPRIGYCQSLNFLAGLLLLFVETEEQCFWLLNVITVVYLPGTHDMSLEGSKVDLGVLMTELRDTMPA
VWDKIGGELEASTSSSRATTASATSSAAARPGRKLWRRDQPQLSTERLPPITLCMTAWFMSCYIGTLPMETTLRV
WDVFFYEGSKTLFRIALAIFKSGEAEIKAVSDPMEMFGVVQSLPRRMLDANGLIETCFKRRNGFGHLSQDAIDER
RQERRDKVRTATAPTATGTTMTDDEAARRKGGTLFGRRRRDASRTRES*
Coding >Ophcf2|04593
ATGTACTCGATGGCCGTCTCCCACCTCGATACCGGTGCCTCCATCGATCGGCAGCGCAGCATCTCCAACCGTCAA
TGCTCCGTCTACGCCTCGCGCCTCAGGCCCAGCCTCTCGCCCATCGACACGGCCGAACAGGCCATGCAGCTACCG
CAGCTACCGCCGCTTCCCGTCTCTCCCCGCTGGGACTCGCTGTCCAACGGTACGCACCTGATACTGTCGAGTCCA
TCCGACGACGAGGCCAGCCTGGCAGAGCGCCGCGGAAGAGCCGCGCCCGAGTTGCTGCTCAAGACGAGCGTCGAA
AACTTTTCTAGACCGCGCAAGCAGAGCCTACGCCAGCCATCGGAACAAAGCAACCCCGTCCCCCGACTGTTAGCC
ACAACGCCCACGGACCTCTACGACCTATGCGCCTCTACGCCTCATACGCCCCCTCCCTGGCAGCGCCCTAGGCGG
AGACCCTCGGCCTCGTCCTTCAAGTCGGCCTCACCATTCTCCTCCCCGCTGGGGCCCCCTCCGTCTGTCGACCTG
CCCGTTCCCAAGCCCGGCCGTGCCCGGAATGCCGCCGGCCCGCCCCTGACGACCGCCGCCCGGGCCCCGTTGGCC
ACCTCTCCCATGGCGGCCGGTGGGGGGGCCGCTCCCTGGATGTCCGACGAGAGACTCCGCTCTAGTTTCAGGTCC
CAACTGACTGAGTCGTCCGCGTTTGGGACCACGGAGCGCAGCAGCGTCCTGACAAAGGATAGCTCCATCACGTCG
CTGTACACGGACGAGCCGAGCGTCGAAGATGTCATGTGCATGTACGAAAAGGGCTTTGCCGACGACGACGACGAC
GACGACGACCACCACCACCGAGAGAAACAAGAGGGGAGACGAGGGGAGGGTCAAAGAGGAGGCCGACACAACCAT
CTCGCAGGAGACGACGAAGGCGACGGCGACGACGACGCTGACGACGACGAAGACGACGACGAAGACGACTTCGAC
ATCGACGGCGACAGCGACGGCTTCCACCGCAACGCCAGCGTCGTGACGGCCACTCTCAAAGACGCTGCCCGTCCC
CTGACGGCCATGTCGGAACCCGCGGCCGATGCCTACCTGGCGCCGCCCGCTACGCGCTCCGCCCTCGACGCCGAG
ATCCGTCGGTCCAAGATGCTCTTCGTCAGCCCCGCCTTTACCGCCTCGGTGCCGGCCCTCTCCGGCGCCGCCGAC
CTCGACGTGACGACGGAGAAGCGAGACTCGGGCAAGTCGCTCGACTCGGCGCCGTCCATGACCTCTTCGGGCCCG
CCGCTGCCGCCGCCGACGACGGAGCCCACGCCTCCCCGAACATCGCCGACGTCGCTGTTCCGAGCCGCCATGGAG
CCCGAAGACCCGGGCTCGCGCGACCGGTACGGCTTCAAGAAGCAGAACCAGTCCGTCACCAGGGAACAGTACGAC
GCCTGGAACAAGGACTACACCCCCTACCTCGCCCGGCGACGCAAGAAATGGGCCGCCTACCTCAAGGAGTGCGGC
CTCATGACGGACCGCCCCATGCGATTCCCTCCTCCCAACGGCAAGACGAAGCGCTTCGTCCGCAAGGGCATCCCG
CCCGACTGGCGAGGCGCCGCCTGGTTCTACTACGCCGGCGGTCCCGCCATCCTGGCCCAGCACTCGGGCCTGTAC
GAGAAGCTGCTGCAGCGCGAGGCCAAGCCCGTCGACGTCGAGGCCATCGAGCGCGACCTCCACCGCACCTTTCCC
GACAACGTCCAGTTCCAGCCGTCGCCGGGCTCCGACGCCGCCACCGAGCCGCCCATCATCTCGTCGCTGCGTCGC
GTCCTCCACGCCTTCGCCGTCTACAACCCGCGCATAGGCTACTGCCAGAGCCTCAACTTCCTCGCCGGCCTGCTG
CTTCTGTTCGTCGAGACGGAGGAGCAGTGCTTCTGGCTTCTCAACGTCATCACCGTCGTCTACCTGCCCGGCACC
CACGACATGAGCCTCGAGGGGTCCAAGGTGGACCTGGGCGTGCTGATGACGGAGCTGCGCGACACCATGCCGGCC
GTGTGGGACAAGATCGGCGGCGAGCTCGAGGCCTCGACGTCATCGTCGCGGGCCACGACGGCATCGGCTACCTCT
TCGGCCGCGGCCAGGCCCGGCCGGAAGCTGTGGCGGCGCGACCAGCCGCAGCTCTCTACCGAACGGCTACCGCCC
ATTACGCTGTGCATGACGGCCTGGTTCATGAGCTGCTACATCGGCACGCTGCCCATGGAGACGACGTTGCGCGTC
TGGGACGTCTTCTTTTACGAGGGCTCCAAGACGCTCTTCCGCATCGCCCTGGCCATCTTCAAGAGCGGCGAGGCC
GAGATCAAGGCCGTGTCTGACCCGATGGAGATGTTTGGCGTCGTCCAGAGCCTGCCCCGGCGGATGCTCGACGCC
AACGGCCTGATAGAGACGTGCTTCAAGCGCCGCAACGGCTTCGGTCACCTGAGTCAGGACGCCATCGACGAGCGG
CGTCAGGAGCGGCGCGACAAGGTGCGGACCGCCACGGCTCCCACGGCCACGGGCACGACCATGACGGACGACGAG
GCGGCGCGTCGGAAGGGAGGGACCCTGTTTGGCCGACGGCGGAGAGACGCCTCGCGGACGCGGGAGTCGTAG
Transcript >Ophcf2|04593
ATGTACTCGATGGCCGTCTCCCACCTCGATACCGGTGCCTCCATCGATCGGCAGCGCAGCATCTCCAACCGTCAA
TGCTCCGTCTACGCCTCGCGCCTCAGGCCCAGCCTCTCGCCCATCGACACGGCCGAACAGGCCATGCAGCTACCG
CAGCTACCGCCGCTTCCCGTCTCTCCCCGCTGGGACTCGCTGTCCAACGGTACGCACCTGATACTGTCGAGTCCA
TCCGACGACGAGGCCAGCCTGGCAGAGCGCCGCGGAAGAGCCGCGCCCGAGTTGCTGCTCAAGACGAGCGTCGAA
AACTTTTCTAGACCGCGCAAGCAGAGCCTACGCCAGCCATCGGAACAAAGCAACCCCGTCCCCCGACTGTTAGCC
ACAACGCCCACGGACCTCTACGACCTATGCGCCTCTACGCCTCATACGCCCCCTCCCTGGCAGCGCCCTAGGCGG
AGACCCTCGGCCTCGTCCTTCAAGTCGGCCTCACCATTCTCCTCCCCGCTGGGGCCCCCTCCGTCTGTCGACCTG
CCCGTTCCCAAGCCCGGCCGTGCCCGGAATGCCGCCGGCCCGCCCCTGACGACCGCCGCCCGGGCCCCGTTGGCC
ACCTCTCCCATGGCGGCCGGTGGGGGGGCCGCTCCCTGGATGTCCGACGAGAGACTCCGCTCTAGTTTCAGGTCC
CAACTGACTGAGTCGTCCGCGTTTGGGACCACGGAGCGCAGCAGCGTCCTGACAAAGGATAGCTCCATCACGTCG
CTGTACACGGACGAGCCGAGCGTCGAAGATGTCATGTGCATGTACGAAAAGGGCTTTGCCGACGACGACGACGAC
GACGACGACCACCACCACCGAGAGAAACAAGAGGGGAGACGAGGGGAGGGTCAAAGAGGAGGCCGACACAACCAT
CTCGCAGGAGACGACGAAGGCGACGGCGACGACGACGCTGACGACGACGAAGACGACGACGAAGACGACTTCGAC
ATCGACGGCGACAGCGACGGCTTCCACCGCAACGCCAGCGTCGTGACGGCCACTCTCAAAGACGCTGCCCGTCCC
CTGACGGCCATGTCGGAACCCGCGGCCGATGCCTACCTGGCGCCGCCCGCTACGCGCTCCGCCCTCGACGCCGAG
ATCCGTCGGTCCAAGATGCTCTTCGTCAGCCCCGCCTTTACCGCCTCGGTGCCGGCCCTCTCCGGCGCCGCCGAC
CTCGACGTGACGACGGAGAAGCGAGACTCGGGCAAGTCGCTCGACTCGGCGCCGTCCATGACCTCTTCGGGCCCG
CCGCTGCCGCCGCCGACGACGGAGCCCACGCCTCCCCGAACATCGCCGACGTCGCTGTTCCGAGCCGCCATGGAG
CCCGAAGACCCGGGCTCGCGCGACCGGTACGGCTTCAAGAAGCAGAACCAGTCCGTCACCAGGGAACAGTACGAC
GCCTGGAACAAGGACTACACCCCCTACCTCGCCCGGCGACGCAAGAAATGGGCCGCCTACCTCAAGGAGTGCGGC
CTCATGACGGACCGCCCCATGCGATTCCCTCCTCCCAACGGCAAGACGAAGCGCTTCGTCCGCAAGGGCATCCCG
CCCGACTGGCGAGGCGCCGCCTGGTTCTACTACGCCGGCGGTCCCGCCATCCTGGCCCAGCACTCGGGCCTGTAC
GAGAAGCTGCTGCAGCGCGAGGCCAAGCCCGTCGACGTCGAGGCCATCGAGCGCGACCTCCACCGCACCTTTCCC
GACAACGTCCAGTTCCAGCCGTCGCCGGGCTCCGACGCCGCCACCGAGCCGCCCATCATCTCGTCGCTGCGTCGC
GTCCTCCACGCCTTCGCCGTCTACAACCCGCGCATAGGCTACTGCCAGAGCCTCAACTTCCTCGCCGGCCTGCTG
CTTCTGTTCGTCGAGACGGAGGAGCAGTGCTTCTGGCTTCTCAACGTCATCACCGTCGTCTACCTGCCCGGCACC
CACGACATGAGCCTCGAGGGGTCCAAGGTGGACCTGGGCGTGCTGATGACGGAGCTGCGCGACACCATGCCGGCC
GTGTGGGACAAGATCGGCGGCGAGCTCGAGGCCTCGACGTCATCGTCGCGGGCCACGACGGCATCGGCTACCTCT
TCGGCCGCGGCCAGGCCCGGCCGGAAGCTGTGGCGGCGCGACCAGCCGCAGCTCTCTACCGAACGGCTACCGCCC
ATTACGCTGTGCATGACGGCCTGGTTCATGAGCTGCTACATCGGCACGCTGCCCATGGAGACGACGTTGCGCGTC
TGGGACGTCTTCTTTTACGAGGGCTCCAAGACGCTCTTCCGCATCGCCCTGGCCATCTTCAAGAGCGGCGAGGCC
GAGATCAAGGCCGTGTCTGACCCGATGGAGATGTTTGGCGTCGTCCAGAGCCTGCCCCGGCGGATGCTCGACGCC
AACGGCCTGATAGAGACGTGCTTCAAGCGCCGCAACGGCTTCGGTCACCTGAGTCAGGACGCCATCGACGAGCGG
CGTCAGGAGCGGCGCGACAAGGTGCGGACCGCCACGGCTCCCACGGCCACGGGCACGACCATGACGGACGACGAG
GCGGCGCGTCGGAAGGGAGGGACCCTGTTTGGCCGACGGCGGAGAGACGCCTCGCGGACGCGGGAGTCGTAG
Gene >Ophcf2|04593
ATGTACTCGATGGCCGTCTCCCACCTCGATACCGGTGCCTCCATCGATCGGCAGCGCAGCATCTCCAACCGTCAA
TGCTCCGTCTACGCCTCGCGCCTCAGGCCCAGCCTCTCGCCCATCGACACGGCCGAACAGGCCATGCAGCTACCG
CAGCTACCGCCGCTTCCCGTCTCTCCCCGCTGGGACTCGCTGTCCAACGGTACGCACCTGATACTGTCGAGTCCA
TCCGACGACGAGGCCAGCCTGGCAGAGCGCCGCGGAAGAGCCGCGCCCGAGTTGCTGCTCAAGACGAGCGTCGAA
AACTTTTCTAGACCGCGCAAGCAGAGCCTACGCCAGCCATCGGAACAAAGCAACCCCGTCCCCCGACTGTTAGCC
ACAACGCCCACGGACCTCTACGACCTATGCGCCTCTACGCCTCATACGCCCCCTCCCTGGCAGCGCCCTAGGCGG
AGACCCTCGGCCTCGTCCTTCAAGTCGGCCTCACCATTCTCCTCCCCGCTGGGGCCCCCTCCGTCTGTCGACCTG
CCCGTTCCCAAGCCCGGCCGTGCCCGGAATGCCGCCGGCCCGCCCCTGACGACCGCCGCCCGGGCCCCGTTGGCC
ACCTCTCCCATGGCGGCCGGTGGGGGGGCCGCTCCCTGGATGTCCGACGAGAGACTCCGCTCTAGTTTCAGGTCC
CAACTGACTGAGTCGTCCGCGTTTGGGACCACGGAGCGCAGCAGCGTCCTGACAAAGGATAGCTCCATCACGTCG
CTGTACACGGACGAGCCGAGCGTCGAAGATGTCATGTGCATGTACGAAAAGGGCTTTGCCGACGACGACGACGAC
GACGACGACCACCACCACCGAGAGAAACAAGAGGGGAGACGAGGGGAGGGTCAAAGAGGAGGCCGACACAACCAT
CTCGCAGGAGACGACGAAGGCGACGGCGACGACGACGCTGACGACGACGAAGACGACGACGAAGACGACTTCGAC
ATCGACGGCGACAGCGACGGCTTCCACCGCAACGCCAGCGTCGTGACGGCCACTCTCAAAGACGCTGCCCGTCCC
CTGACGGCCATGTCGGAACCCGCGGCCGATGCCTACCTGGCGCCGCCCGCTACGCGCTCCGCCCTCGACGCCGAG
ATCCGTCGGTCCAAGATGCTCTTCGTCAGCCCCGCCTTTACCGCCTCGGTGCCGGCCCTCTCCGGCGCCGCCGAC
CTCGACGTGACGACGGAGAAGCGAGACTCGGGCAAGTCGCTCGACTCGGCGCCGTCCATGACCTCTTCGGGCCCG
CCGCTGCCGCCGCCGACGACGGAGCCCACGCCTCCCCGAACATCGCCGACGTCGCTGTTCCGAGCCGCCATGGAG
CCCGAAGACCCGGGCTCGCGCGACCGGTACGGCTTCAAGAAGCAGAACCAGTCCGTCACCAGGGAACAGTACGAC
GCCTGGAACAAGGACTACACCCCCTACCTCGCCCGGCGACGCAAGAAATGGGCCGCCTACCTCAAGGAGTGCGGC
CTCATGACGGACCGCCCCATGCGATTCCCTCCTCCCAACGGCAAGACGAAGCGCTTCGTCCGCAAGGGCATCCCG
CCCGACTGGCGAGGCGCCGCCTGGTTCTACTACGCCGGCGGTCCCGCCATCCTGGCCCAGCACTCGGGCCTGTAC
GAGAAGCTGCTGCAGCGCGAGGCCAAGCCCGTCGACGTCGAGGCCATCGAGCGCGACCTCCACCGCACCTTTCCC
GACAACGTCCAGTTCCAGCCGTCGCCGGGCTCCGACGCCGCCACCGAGCCGCCCATCATCTCGTCGCTGCGTCGC
GTCCTCCACGCCTTCGCCGTCTACAACCCGCGCATAGGCTACTGCCAGAGCCTCAACTTCCTCGCCGGCCTGCTG
CTTCTGTTCGTCGAGACGGAGGAGCAGTGCTTCTGGCTTCTCAACGTCATCACCGTCGTCTACCTGCCCGGCACC
CACGACATGAGCCTCGAGGGGTCCAAGGTGGACCTGGGCGTGCTGATGACGGAGCTGCGCGACACCATGCCGGCC
GTGTGGGACAAGATCGGCGGCGAGCTCGAGGCCTCGACGTCATCGTCGCGGGCCACGACGGCATCGGCTACCTCT
TCGGCCGCGGCCAGGCCCGGCCGGAAGCTGTGGCGGCGCGACCAGCCGCAGCTCTCTACCGAACGGCTACCGCCC
ATTACGCTGTGCATGACGGCCTGGTTCATGAGCTGCTACATCGGCACGCTGCCCATGGAGACGACGTTGCGCGTC
TGGGACGTCTTCTTTTACGAGGGCTCCAAGACGCTCTTCCGCATCGCCCTGGCCATCTTCAAGAGCGGCGAGGCC
GAGATCAAGGCCGTGTCTGACCCGATGGAGATGTTTGGCGTCGTCCAGAGCCTGCCCCGGCGGATGCTCGACGCC
AACGGCCTGATAGAGACGTGCTTCAAGCGCCGCAACGGCTTCGGTCACCTGAGTCAGGACGCCATCGACGAGCGG
CGTCAGGAGCGGCGCGACAAGGTGCGGACCGCCACGGCTCCCACGGCCACGGGCACGACCATGACGGACGACGAG
GCGGCGCGTCGGAAGGGAGGGACCCTGTTTGGCCGACGGCGGAGAGACGCCTCGCGGACGCGGGAGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail