Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04590
Gene name
Locationscaffold_04:3653475..3655186
Strand-
Gene length (bp)1711
Transcript length (bp)1512
Coding sequence length (bp)1512
Protein length (aa) 504

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 3.6E-23 60 195

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1575 0.0713 0.9319 0.0846 0.0717 0.0122 0.1644 0.2551 0.0829 0.0359

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999758

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA7 5.2E-53 49 488

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup23
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1466
Ophiocordyceps australis 1348a (Ghana) OphauG2|2796
Ophiocordyceps australis map64 (Brazil) OphauB2|3994
Ophiocordyceps australis map64 (Brazil) OphauB2|591
Ophiocordyceps australis map64 (Brazil) OphauB2|6458
Ophiocordyceps camponoti-floridani Ophcf2|06420
Ophiocordyceps camponoti-floridani Ophcf2|02533
Ophiocordyceps camponoti-floridani Ophcf2|04590 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06808
Ophiocordyceps camponoti-rufipedis Ophun1|3755
Ophiocordyceps camponoti-rufipedis Ophun1|2002
Ophiocordyceps camponoti-rufipedis Ophun1|1119
Ophiocordyceps camponoti-rufipedis Ophun1|7502
Ophiocordyceps camponoti-rufipedis Ophun1|4159
Ophiocordyceps kimflemingae Ophio5|2066
Ophiocordyceps kimflemingae Ophio5|3352
Ophiocordyceps kimflemingae Ophio5|360
Ophiocordyceps kimflemingae Ophio5|4122
Ophiocordyceps kimflemingae Ophio5|5606
Ophiocordyceps subramaniannii Hirsu2|7822
Ophiocordyceps subramaniannii Hirsu2|6429
Ophiocordyceps subramaniannii Hirsu2|16
Ophiocordyceps subramaniannii Hirsu2|10639

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04590
MKHLHVTLALASASLVTATPAAEPCNTLAHELPALFHGPISPEYDGLVQARWSGTSVIRPACIITPASANDVSRT
MRILTRHQCRFAVKGGGHNANPGANSIADGVSIDLRRMDSANLARDRSYVSLGAGLTWGRAYDMFNNSRVGFPGG
VCEGVGVGGVSLGGGQSLFQAKKGWVVDNILEYQLVLASGNIVTASPHRRTDLFKALKGGNTNFGIVTRVKIAAF
DFPGLWSGQVIASLDHGPSNRSSMLDSVSHAMVDFVADNNRDVDSEVQLAVSYLRNNSRQVASAAISNVADVANP
PSLRRFSDLPNRVSFIGRHGKIADFTHDLSRFQPIGFRQVTAGVTITNDFDTLRHIWDASDEVYNSLPQKDKVDW
IVVLFPQPVVQQSYSKKRGGNSLGLSNNKDDQIVVWLASRWSDPSLDGMMEQARRDFIKATVAVAKKNKKYSPFI
YANYAAPDQDPLCGYGAESVAFLKRTANKYDPKGVFQKLMPGGFKISQAHCRG*
Coding >Ophcf2|04590
ATGAAGCATCTTCACGTCACCCTGGCCCTGGCCTCTGCTAGTCTCGTCACGGCCACCCCTGCCGCAGAGCCATGC
AACACTCTCGCCCACGAACTACCAGCCCTCTTCCACGGTCCCATCTCCCCCGAGTACGATGGCCTCGTCCAGGCC
CGCTGGTCAGGAACATCGGTGATCAGACCAGCTTGTATCATAACGCCAGCGTCAGCCAACGATGTCTCACGAACG
ATGCGGATTCTAACGAGGCACCAATGCCGCTTCGCCGTAAAGGGGGGCGGTCACAACGCCAACCCGGGGGCTAAT
AGCATTGCTGACGGCGTCTCCATCGATCTCCGGCGTATGGATTCTGCGAACCTGGCTCGGGATAGGTCGTACGTG
AGTCTCGGCGCTGGCTTGACCTGGGGTCGGGCCTATGACATGTTCAACAACAGTCGTGTTGGCTTCCCCGGAGGC
GTTTGCGAAGGCGTCGGCGTGGGAGGCGTCTCTCTCGGAGGAGGACAGTCGTTGTTCCAAGCAAAGAAAGGCTGG
GTGGTCGACAATATCCTCGAATATCAACTCGTTCTAGCATCAGGCAACATCGTGACAGCCTCTCCCCACCGCAGA
ACAGACCTCTTCAAAGCCCTCAAAGGCGGGAACACAAACTTCGGCATCGTCACCCGCGTCAAGATCGCCGCCTTC
GACTTCCCTGGCCTATGGAGCGGCCAAGTCATCGCCAGTCTCGACCACGGACCCAGCAACCGCTCCTCCATGCTG
GACAGCGTCAGCCACGCCATGGTCGACTTCGTGGCGGATAATAATCGCGATGTTGACTCGGAGGTGCAGCTTGCT
GTTAGCTATCTGCGGAATAATAGCCGTCAGGTTGCCAGCGCGGCGATTTCGAACGTTGCGGACGTGGCGAATCCG
CCTTCGTTACGGCGGTTTTCTGACTTGCCTAACCGGGTTTCCTTCATTGGGAGGCATGGGAAGATTGCGGACTTT
ACACATGATCTGAGTCGCTTTCAGCCGATTGGATTCCGCCAAGTCACCGCTGGCGTCACCATTACAAACGACTTC
GATACTCTCCGCCACATCTGGGACGCCTCGGACGAAGTTTACAACTCGCTCCCACAGAAAGACAAAGTCGACTGG
ATCGTCGTTCTCTTCCCCCAGCCCGTCGTCCAGCAGTCGTACTCTAAGAAGCGAGGCGGTAACAGCCTCGGCCTC
TCCAACAACAAGGACGACCAGATCGTCGTCTGGCTTGCCTCTCGCTGGTCAGACCCCAGCCTCGACGGCATGATG
GAACAGGCTCGACGAGACTTTATCAAGGCTACCGTGGCGGTAGCTAAGAAGAACAAGAAATACTCGCCCTTTATC
TACGCCAACTACGCCGCTCCCGATCAGGATCCTCTCTGCGGCTACGGCGCCGAATCCGTCGCCTTTTTGAAGCGG
ACTGCTAACAAGTACGACCCGAAAGGTGTCTTCCAGAAGCTGATGCCGGGAGGCTTCAAGATTAGCCAGGCCCAT
TGTCGCGGGTAG
Transcript >Ophcf2|04590
ATGAAGCATCTTCACGTCACCCTGGCCCTGGCCTCTGCTAGTCTCGTCACGGCCACCCCTGCCGCAGAGCCATGC
AACACTCTCGCCCACGAACTACCAGCCCTCTTCCACGGTCCCATCTCCCCCGAGTACGATGGCCTCGTCCAGGCC
CGCTGGTCAGGAACATCGGTGATCAGACCAGCTTGTATCATAACGCCAGCGTCAGCCAACGATGTCTCACGAACG
ATGCGGATTCTAACGAGGCACCAATGCCGCTTCGCCGTAAAGGGGGGCGGTCACAACGCCAACCCGGGGGCTAAT
AGCATTGCTGACGGCGTCTCCATCGATCTCCGGCGTATGGATTCTGCGAACCTGGCTCGGGATAGGTCGTACGTG
AGTCTCGGCGCTGGCTTGACCTGGGGTCGGGCCTATGACATGTTCAACAACAGTCGTGTTGGCTTCCCCGGAGGC
GTTTGCGAAGGCGTCGGCGTGGGAGGCGTCTCTCTCGGAGGAGGACAGTCGTTGTTCCAAGCAAAGAAAGGCTGG
GTGGTCGACAATATCCTCGAATATCAACTCGTTCTAGCATCAGGCAACATCGTGACAGCCTCTCCCCACCGCAGA
ACAGACCTCTTCAAAGCCCTCAAAGGCGGGAACACAAACTTCGGCATCGTCACCCGCGTCAAGATCGCCGCCTTC
GACTTCCCTGGCCTATGGAGCGGCCAAGTCATCGCCAGTCTCGACCACGGACCCAGCAACCGCTCCTCCATGCTG
GACAGCGTCAGCCACGCCATGGTCGACTTCGTGGCGGATAATAATCGCGATGTTGACTCGGAGGTGCAGCTTGCT
GTTAGCTATCTGCGGAATAATAGCCGTCAGGTTGCCAGCGCGGCGATTTCGAACGTTGCGGACGTGGCGAATCCG
CCTTCGTTACGGCGGTTTTCTGACTTGCCTAACCGGGTTTCCTTCATTGGGAGGCATGGGAAGATTGCGGACTTT
ACACATGATCTGAGTCGCTTTCAGCCGATTGGATTCCGCCAAGTCACCGCTGGCGTCACCATTACAAACGACTTC
GATACTCTCCGCCACATCTGGGACGCCTCGGACGAAGTTTACAACTCGCTCCCACAGAAAGACAAAGTCGACTGG
ATCGTCGTTCTCTTCCCCCAGCCCGTCGTCCAGCAGTCGTACTCTAAGAAGCGAGGCGGTAACAGCCTCGGCCTC
TCCAACAACAAGGACGACCAGATCGTCGTCTGGCTTGCCTCTCGCTGGTCAGACCCCAGCCTCGACGGCATGATG
GAACAGGCTCGACGAGACTTTATCAAGGCTACCGTGGCGGTAGCTAAGAAGAACAAGAAATACTCGCCCTTTATC
TACGCCAACTACGCCGCTCCCGATCAGGATCCTCTCTGCGGCTACGGCGCCGAATCCGTCGCCTTTTTGAAGCGG
ACTGCTAACAAGTACGACCCGAAAGGTGTCTTCCAGAAGCTGATGCCGGGAGGCTTCAAGATTAGCCAGGCCCAT
TGTCGCGGGTAG
Gene >Ophcf2|04590
ATGAAGCATCTTCACGTCACCCTGGCCCTGGCCTCTGCTAGTCTCGTCACGGCCACCCCTGCCGCAGAGCCAGTG
AGCTCCGTCTGCGTAAGCACAACCACGAGAGGGACATACTCAAGGGGGACCAGCTCTGACGAAGCCTCACAGTGC
AACACTCTCGCCCACGAACTACCAGCCCTCTTCCACGGTCCCATCTCCCCCGAGTACGATGGCCTCGTCCAGGCC
CGCTGGTCAGGAACATCGGTGATCAGACCAGCTTGTATCATAACGCCAGCGTCAGCCAACGATGTCTCACGAACG
ATGCGGATTCTAACGAGGCACCAATGCCGCTTCGCCGTAAAGGGGGGCGGTCACAACGCCAACCCGGGGGCTAAT
AGCATTGCTGACGGCGTCTCCATCGATCTCCGGCGTATGGATTCTGCGAACCTGGCTCGGGATAGGTCGTACGTG
AGTCTCGGCGCTGGCTTGACCTGGGGTCGGGCCTATGACATGTTCAACAACAGTCGTGTTGGCTTCCCCGGAGGC
GTTTGCGAAGGCGTCGGCGTGGGAGGCGTCTCTCTCGGAGGAGGACAGTCGTTGTTCCAAGCAAAGAAAGGCTGG
GTGGTCGACAATATCCTCGAATATCAACTCGTTCTAGCATCAGGCAACATCGTGACAGCCTCTCCCCACCGCAGA
ACAGACCTCTTCAAAGCCCTCAAAGGCGGGAACACAAACTTCGGCATCGTCACCCGCGTCAAGATCGCCGCCTTC
GACTTCCCTGGCCTATGGAGCGGCCAAGTCATCGCCAGTCTCGACCACGGACCCAGCAACCGCTCCTCCATGCTG
GACAGCGTCAGCCACGCCATGGTCGACTTCGTGGCGGATAATAATCGCGATGTTGACTCGGAGGTGCAGCTTGCT
GTTAGCTATCTGCGGAATAATAGCCGTCAGGTTGCCAGCGCGGCGATTTCGAACGTTGCGGACGTGGCGAATCCG
CCTTCGTTACGGCGGTTTTCTGACTTGCCTAACCGGGTTTCCTTCATTGGGAGGCATGGGAAGATTGCGGACTTT
ACACATGATCTGAGTCGCTTTCAGCCGATTGGATTCCGGTGAGTTCCCCTTTTCAGATTGTGGCTTCTTGTCTAC
CGAGTTCTAAACCAGGTCTTTAGCCAAGTCACCGCTGGCGTCACCATTACAAACGACTTCGATACTCTCCGCCAC
ATCTGGGACGCCTCGGACGAAGTTTACAACTCGCTCCCACAGAAAGACAAAGTCGACTGGATCGTCGTTCTCTTC
CCCCAGCCCGTCGTCCAGCAGTCGTACTCTAAGAAGCGAGGCGGTAACAGCCTCGGCCTCTCCAACAACAAGGAC
GACCAGATCGGTGAGTCTCTACGTGTACCGCATCGTGATATCACCTCAAGCCCGTGACTGACCGGTCTCCGCAGT
CGTCTGGCTTGCCTCTCGCTGGTCAGACCCCAGCCTCGACGGCATGATGGAACAGGCTCGACGAGACTTTATCAA
GGCTACCGTGGCGGTAGCTAAGAAGAACAAGAAATACTCGCCCTTTATCTACGCCAACTACGCCGCTCCCGATCA
GGATCCTCTCTGCGGCTACGGCGCCGAATCCGTCGCCTTTTTGAAGCGGACTGCTAACAAGTACGACCCGAAAGG
TGTCTTCCAGAAGCTGATGCCGGGAGGCTTCAAGATTAGCCAGGCCCATTGTCGCGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail