Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04584
Gene name
Locationscaffold_04:3640234..3641980
Strand+
Gene length (bp)1746
Transcript length (bp)1746
Coding sequence length (bp)1746
Protein length (aa) 582

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00732 GMC_oxred_N GMC oxidoreductase 1.3E-46 8 308
PF05199 GMC_oxred_C GMC oxidoreductase 2.5E-31 429 567

GO

GO Term Description Terminal node
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.6468 0.2354 0.109 0.0582 0.1609 0.0119 0.127 0.1173 0.0537 0.1325

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA3_2 1.1E-141 7 574

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup424
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7394
Ophiocordyceps australis map64 (Brazil) OphauB2|1715
Ophiocordyceps camponoti-floridani Ophcf2|04584 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04812
Ophiocordyceps camponoti-rufipedis Ophun1|446
Ophiocordyceps camponoti-rufipedis Ophun1|5709
Ophiocordyceps camponoti-rufipedis Ophun1|6194
Ophiocordyceps kimflemingae Ophio5|2275
Ophiocordyceps kimflemingae Ophio5|7134
Ophiocordyceps subramaniannii Hirsu2|436

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04584
MASDGSHYDFIVVGGGTAGNVVAGRLAENANVSILIVEAGIGNPREVTDITTPALAMDLRGSDHDWQYKTTMVRR
DDYERIEKPNTRGKALGGSSSLNYFTWIPGCKPTFDMWEEYGGKEWTWDPLVPYLRKSAKYHDDDGLYSPDLNKI
GPDGHIPISHCELIEEMAPFRENVIKAWKSHGGEMTENIYDGEMNGLTHCCASIYHGQRSGSWWFLEDKPKITVC
AEATSKNLIIDKADKTCKGVTVIKEGKEMSFFADREVIVSEGVFETPKLLKLSGIGPADELKRHGIETVVDSQHV
GEHLLDHPGVPFVLEVKPGFGCEDELIRPGPKHEAAVARYKDNKGGNKGPMGSGLLELVGFPRIDDYLEKDETYR
KAKAANGGKDIFSPEGQPHFELDFVCMFGKAFQWHYPIPKEGNYTTVMVDLVRPVSEGGTVKLRSTDPLEQADIN
LNFFADDLDIIAMREGIRYTYDVLLKGDGFKDLVVKQYPWDMPLDDDKAMHRAVLDRCQTSFHPCGTARLSKNIE
QGVVDAQLKVHGMKNLRVIDASVIPVIPDCRIQNSVYMCAEKGADAIKAAHADLYK*
Coding >Ophcf2|04584
ATGGCCTCTGACGGATCTCACTACGACTTCATCGTCGTTGGAGGTGGCACTGCTGGAAATGTCGTCGCCGGCCGT
CTCGCCGAGAACGCCAATGTCTCCATCTTGATCGTCGAGGCCGGTATCGGCAACCCCCGCGAGGTGACGGACATC
ACGACGCCCGCTCTGGCCATGGACCTCCGTGGCAGCGATCACGACTGGCAGTACAAGACGACAATGGTCAGGCGT
GATGACTACGAGCGTATCGAGAAGCCCAATACCCGTGGCAAGGCGCTCGGTGGCAGCTCGTCTCTCAACTACTTC
ACCTGGATCCCGGGCTGCAAGCCTACCTTTGATATGTGGGAGGAGTACGGTGGAAAGGAGTGGACGTGGGATCCT
CTGGTTCCTTACCTGCGGAAGTCGGCCAAGTATCACGACGACGATGGCCTCTACTCTCCCGACCTGAACAAGATC
GGTCCCGACGGCCACATCCCCATCTCCCACTGCGAACTGATAGAGGAGATGGCGCCTTTCCGCGAGAACGTCATC
AAGGCTTGGAAGTCGCATGGCGGCGAGATGACGGAGAACATCTACGATGGCGAGATGAACGGTCTGACACACTGC
TGCGCATCCATCTATCACGGCCAGCGCTCCGGAAGCTGGTGGTTCCTCGAGGACAAGCCCAAGATCACCGTCTGC
GCCGAAGCGACGTCCAAGAACCTCATCATCGACAAGGCCGACAAGACGTGCAAGGGCGTGACGGTCATCAAGGAG
GGCAAGGAGATGAGCTTCTTTGCTGATCGCGAGGTCATCGTTTCCGAGGGTGTCTTCGAGACGCCTAAGCTGTTG
AAGCTCAGCGGTATCGGCCCGGCTGACGAGCTGAAGAGGCATGGGATCGAGACGGTGGTCGACTCGCAGCATGTT
GGCGAGCATCTGCTGGATCACCCTGGTGTTCCTTTTGTTCTCGAGGTTAAGCCGGGTTTTGGTTGCGAAGACGAG
CTGATTCGTCCTGGTCCTAAGCATGAAGCTGCTGTTGCCAGGTACAAGGACAACAAGGGAGGTAACAAGGGACCC
ATGGGCTCTGGTCTGCTCGAGCTTGTCGGTTTCCCTCGCATAGACGACTATCTCGAGAAGGATGAGACCTACCGC
AAGGCCAAGGCTGCCAACGGCGGCAAGGACATCTTCAGCCCCGAGGGCCAGCCTCACTTCGAGCTCGACTTCGTC
TGCATGTTCGGCAAGGCTTTCCAGTGGCACTACCCGATCCCCAAGGAGGGCAACTACACGACTGTCATGGTTGAT
CTCGTCCGGCCAGTCTCTGAGGGCGGAACCGTCAAGCTTCGCAGCACCGATCCTCTCGAGCAGGCGGATATCAAC
CTCAACTTCTTCGCCGACGACCTCGACATCATCGCCATGCGTGAGGGTATCCGCTACACCTACGACGTTCTCCTC
AAGGGCGATGGCTTCAAGGACCTCGTTGTCAAGCAGTACCCCTGGGACATGCCCCTCGACGACGACAAGGCCATG
CACCGCGCCGTCCTCGACCGCTGCCAGACGTCGTTCCACCCTTGCGGCACTGCCCGTCTGTCCAAGAACATCGAG
CAGGGTGTCGTCGATGCCCAGCTCAAGGTGCACGGCATGAAGAACCTGCGGGTGATTGACGCGTCGGTGATTCCG
GTGATTCCGGATTGTCGGATTCAGAACTCGGTGTACATGTGTGCTGAGAAGGGGGCTGATGCCATCAAGGCTGCC
CACGCGGATCTGTACAAATAG
Transcript >Ophcf2|04584
ATGGCCTCTGACGGATCTCACTACGACTTCATCGTCGTTGGAGGTGGCACTGCTGGAAATGTCGTCGCCGGCCGT
CTCGCCGAGAACGCCAATGTCTCCATCTTGATCGTCGAGGCCGGTATCGGCAACCCCCGCGAGGTGACGGACATC
ACGACGCCCGCTCTGGCCATGGACCTCCGTGGCAGCGATCACGACTGGCAGTACAAGACGACAATGGTCAGGCGT
GATGACTACGAGCGTATCGAGAAGCCCAATACCCGTGGCAAGGCGCTCGGTGGCAGCTCGTCTCTCAACTACTTC
ACCTGGATCCCGGGCTGCAAGCCTACCTTTGATATGTGGGAGGAGTACGGTGGAAAGGAGTGGACGTGGGATCCT
CTGGTTCCTTACCTGCGGAAGTCGGCCAAGTATCACGACGACGATGGCCTCTACTCTCCCGACCTGAACAAGATC
GGTCCCGACGGCCACATCCCCATCTCCCACTGCGAACTGATAGAGGAGATGGCGCCTTTCCGCGAGAACGTCATC
AAGGCTTGGAAGTCGCATGGCGGCGAGATGACGGAGAACATCTACGATGGCGAGATGAACGGTCTGACACACTGC
TGCGCATCCATCTATCACGGCCAGCGCTCCGGAAGCTGGTGGTTCCTCGAGGACAAGCCCAAGATCACCGTCTGC
GCCGAAGCGACGTCCAAGAACCTCATCATCGACAAGGCCGACAAGACGTGCAAGGGCGTGACGGTCATCAAGGAG
GGCAAGGAGATGAGCTTCTTTGCTGATCGCGAGGTCATCGTTTCCGAGGGTGTCTTCGAGACGCCTAAGCTGTTG
AAGCTCAGCGGTATCGGCCCGGCTGACGAGCTGAAGAGGCATGGGATCGAGACGGTGGTCGACTCGCAGCATGTT
GGCGAGCATCTGCTGGATCACCCTGGTGTTCCTTTTGTTCTCGAGGTTAAGCCGGGTTTTGGTTGCGAAGACGAG
CTGATTCGTCCTGGTCCTAAGCATGAAGCTGCTGTTGCCAGGTACAAGGACAACAAGGGAGGTAACAAGGGACCC
ATGGGCTCTGGTCTGCTCGAGCTTGTCGGTTTCCCTCGCATAGACGACTATCTCGAGAAGGATGAGACCTACCGC
AAGGCCAAGGCTGCCAACGGCGGCAAGGACATCTTCAGCCCCGAGGGCCAGCCTCACTTCGAGCTCGACTTCGTC
TGCATGTTCGGCAAGGCTTTCCAGTGGCACTACCCGATCCCCAAGGAGGGCAACTACACGACTGTCATGGTTGAT
CTCGTCCGGCCAGTCTCTGAGGGCGGAACCGTCAAGCTTCGCAGCACCGATCCTCTCGAGCAGGCGGATATCAAC
CTCAACTTCTTCGCCGACGACCTCGACATCATCGCCATGCGTGAGGGTATCCGCTACACCTACGACGTTCTCCTC
AAGGGCGATGGCTTCAAGGACCTCGTTGTCAAGCAGTACCCCTGGGACATGCCCCTCGACGACGACAAGGCCATG
CACCGCGCCGTCCTCGACCGCTGCCAGACGTCGTTCCACCCTTGCGGCACTGCCCGTCTGTCCAAGAACATCGAG
CAGGGTGTCGTCGATGCCCAGCTCAAGGTGCACGGCATGAAGAACCTGCGGGTGATTGACGCGTCGGTGATTCCG
GTGATTCCGGATTGTCGGATTCAGAACTCGGTGTACATGTGTGCTGAGAAGGGGGCTGATGCCATCAAGGCTGCC
CACGCGGATCTGTACAAATAG
Gene >Ophcf2|04584
ATGGCCTCTGACGGATCTCACTACGACTTCATCGTCGTTGGAGGTGGCACTGCTGGAAATGTCGTCGCCGGCCGT
CTCGCCGAGAACGCCAATGTCTCCATCTTGATCGTCGAGGCCGGTATCGGCAACCCCCGCGAGGTGACGGACATC
ACGACGCCCGCTCTGGCCATGGACCTCCGTGGCAGCGATCACGACTGGCAGTACAAGACGACAATGGTCAGGCGT
GATGACTACGAGCGTATCGAGAAGCCCAATACCCGTGGCAAGGCGCTCGGTGGCAGCTCGTCTCTCAACTACTTC
ACCTGGATCCCGGGCTGCAAGCCTACCTTTGATATGTGGGAGGAGTACGGTGGAAAGGAGTGGACGTGGGATCCT
CTGGTTCCTTACCTGCGGAAGTCGGCCAAGTATCACGACGACGATGGCCTCTACTCTCCCGACCTGAACAAGATC
GGTCCCGACGGCCACATCCCCATCTCCCACTGCGAACTGATAGAGGAGATGGCGCCTTTCCGCGAGAACGTCATC
AAGGCTTGGAAGTCGCATGGCGGCGAGATGACGGAGAACATCTACGATGGCGAGATGAACGGTCTGACACACTGC
TGCGCATCCATCTATCACGGCCAGCGCTCCGGAAGCTGGTGGTTCCTCGAGGACAAGCCCAAGATCACCGTCTGC
GCCGAAGCGACGTCCAAGAACCTCATCATCGACAAGGCCGACAAGACGTGCAAGGGCGTGACGGTCATCAAGGAG
GGCAAGGAGATGAGCTTCTTTGCTGATCGCGAGGTCATCGTTTCCGAGGGTGTCTTCGAGACGCCTAAGCTGTTG
AAGCTCAGCGGTATCGGCCCGGCTGACGAGCTGAAGAGGCATGGGATCGAGACGGTGGTCGACTCGCAGCATGTT
GGCGAGCATCTGCTGGATCACCCTGGTGTTCCTTTTGTTCTCGAGGTTAAGCCGGGTTTTGGTTGCGAAGACGAG
CTGATTCGTCCTGGTCCTAAGCATGAAGCTGCTGTTGCCAGGTACAAGGACAACAAGGGAGGTAACAAGGGACCC
ATGGGCTCTGGTCTGCTCGAGCTTGTCGGTTTCCCTCGCATAGACGACTATCTCGAGAAGGATGAGACCTACCGC
AAGGCCAAGGCTGCCAACGGCGGCAAGGACATCTTCAGCCCCGAGGGCCAGCCTCACTTCGAGCTCGACTTCGTC
TGCATGTTCGGCAAGGCTTTCCAGTGGCACTACCCGATCCCCAAGGAGGGCAACTACACGACTGTCATGGTTGAT
CTCGTCCGGCCAGTCTCTGAGGGCGGAACCGTCAAGCTTCGCAGCACCGATCCTCTCGAGCAGGCGGATATCAAC
CTCAACTTCTTCGCCGACGACCTCGACATCATCGCCATGCGTGAGGGTATCCGCTACACCTACGACGTTCTCCTC
AAGGGCGATGGCTTCAAGGACCTCGTTGTCAAGCAGTACCCCTGGGACATGCCCCTCGACGACGACAAGGCCATG
CACCGCGCCGTCCTCGACCGCTGCCAGACGTCGTTCCACCCTTGCGGCACTGCCCGTCTGTCCAAGAACATCGAG
CAGGGTGTCGTCGATGCCCAGCTCAAGGTGCACGGCATGAAGAACCTGCGGGTGATTGACGCGTCGGTGATTCCG
GTGATTCCGGATTGTCGGATTCAGAACTCGGTGTACATGTGTGCTGAGAAGGGGGCTGATGCCATCAAGGCTGCC
CACGCGGATCTGTACAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail