Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04567
Gene name
Locationscaffold_04:3600818..3601949
Strand+
Gene length (bp)1131
Transcript length (bp)765
Coding sequence length (bp)765
Protein length (aa) 255

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family 4.7E-21 188 248

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 53 75 22
3 172 189 17
4 228 250 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 127.51 71.89 183.12
Alive In ants, during behavior modification 149.89 85.85 213.93
Dead In ants, recently dead 154.83 88.82 220.84

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.439617 no
Alive Dead 0.874698 no
Dead Fungus 0.335440 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04567
MSWKLSWRRFWCYFNSQYVYGRVPLVHAIVFLVEMGLIARLTARFNAQYEERPLITMMVTNALLGGIADTVAQGI
SAVRQRTAGKAGVKDEDLDMEMPEIGRKGTFLDRDLLPESKAPPPPFDLERLTRFAAYGFCVAPLQFKWFRFLER
AFPMTKTSAFGPAMKRVVFDQFVYAPFGVGLFFVAMTVAEGGGKRAVSNKLRDMYVPTLKANYVVWPAVQMVNFR
LMPVQFQLPFVSTIGIAWTAYLSLTNASS*
Coding >Ophcf2|04567
ATGTCCTGGAAACTGTCGTGGCGGCGCTTCTGGTGCTACTTCAACAGCCAATATGTCTACGGGCGCGTCCCGCTG
GTGCATGCTATAGTCTTCCTCGTTGAAATGGGTCTCATCGCGCGTCTGACGGCTCGGTTCAATGCCCAGTATGAA
GAACGACCGCTGATAACCATGATGGTCACCAACGCCCTTCTCGGCGGCATAGCCGACACCGTCGCCCAGGGCATC
TCCGCCGTACGCCAACGCACCGCCGGCAAGGCAGGCGTCAAAGACGAAGACTTGGACATGGAGATGCCAGAAATC
GGCCGCAAAGGCACCTTCCTTGATCGCGACTTGCTGCCCGAGTCCAAGGCGCCGCCCCCGCCCTTCGACTTGGAA
CGGCTGACGCGCTTCGCCGCCTATGGCTTCTGCGTTGCGCCCTTGCAGTTCAAGTGGTTCCGATTCCTCGAACGG
GCCTTTCCCATGACCAAGACGAGTGCTTTCGGTCCGGCTATGAAGCGCGTCGTCTTCGACCAGTTCGTGTATGCA
CCCTTTGGTGTCGGTCTCTTCTTCGTCGCCATGACTGTCGCCGAGGGAGGCGGCAAGCGTGCCGTCAGCAACAAG
CTGAGGGACATGTACGTCCCGACGCTCAAGGCCAACTACGTCGTCTGGCCCGCCGTGCAGATGGTAAACTTTCGC
CTGATGCCGGTGCAGTTCCAGCTGCCCTTCGTGTCAACCATCGGTATCGCATGGACAGCCTACCTCTCCCTCACC
AACGCATCTTCCTAG
Transcript >Ophcf2|04567
ATGTCCTGGAAACTGTCGTGGCGGCGCTTCTGGTGCTACTTCAACAGCCAATATGTCTACGGGCGCGTCCCGCTG
GTGCATGCTATAGTCTTCCTCGTTGAAATGGGTCTCATCGCGCGTCTGACGGCTCGGTTCAATGCCCAGTATGAA
GAACGACCGCTGATAACCATGATGGTCACCAACGCCCTTCTCGGCGGCATAGCCGACACCGTCGCCCAGGGCATC
TCCGCCGTACGCCAACGCACCGCCGGCAAGGCAGGCGTCAAAGACGAAGACTTGGACATGGAGATGCCAGAAATC
GGCCGCAAAGGCACCTTCCTTGATCGCGACTTGCTGCCCGAGTCCAAGGCGCCGCCCCCGCCCTTCGACTTGGAA
CGGCTGACGCGCTTCGCCGCCTATGGCTTCTGCGTTGCGCCCTTGCAGTTCAAGTGGTTCCGATTCCTCGAACGG
GCCTTTCCCATGACCAAGACGAGTGCTTTCGGTCCGGCTATGAAGCGCGTCGTCTTCGACCAGTTCGTGTATGCA
CCCTTTGGTGTCGGTCTCTTCTTCGTCGCCATGACTGTCGCCGAGGGAGGCGGCAAGCGTGCCGTCAGCAACAAG
CTGAGGGACATGTACGTCCCGACGCTCAAGGCCAACTACGTCGTCTGGCCCGCCGTGCAGATGGTAAACTTTCGC
CTGATGCCGGTGCAGTTCCAGCTGCCCTTCGTGTCAACCATCGGTATCGCATGGACAGCCTACCTCTCCCTCACC
AACGCATCTTCCTAG
Gene >Ophcf2|04567
ATGTCCTGGAAACTGTCGTGGCGGCGCTTCTGGTGCTACTTCAACAGCCAATATGTCTACGGGCGCGTCGTACGT
GTCGTCCTCAGTTGCTCCACTACTAAGCCTTTCTCCTGATTACCTACGTCGTCGCTTTTTCTTTTTTCCTTTTCT
TTTTTCTTCTTCTTGACTTTCCTTACCTCGACCATTGCCACCGTCGCAACCTCGAGCATCCACTGACGACACGTA
CAGCCGCTGGTGCATGCTATAGTCTTCCTCGTTGAAATGGGTCTCATCGCGCGTCTGACGGCTCGGTTCAATGCC
CAGTATGAAGAACGACCGCGTATGTTCTCACCCACCGCTCCGACATTGCCGCCTGCGAAGCCATGACCTTTTGCC
CCTTTACCTCGCAAGCGACAGAGACCCGCACCCGCCCAACAATCCCATAACGACGCATTCGAAAGAGCTGAACTG
ACTCCCGTTATCCACAGTGATAACCATGATGGTCACCAACGCCCTTCTCGGCGGCATAGCCGACACCGTCGCCCA
GGGCATCTCCGCCGTACGCCAACGCACCGCCGGCAAGGCAGGCGTCAAAGACGAAGACTTGGACATGGAGATGCC
AGAAATCGGCCGCAAAGGCACCTTCCTTGATCGCGACTTGCTGCCCGAGTCCAAGGCGCCGCCCCCGCCCTTCGA
CTTGGAACGGCTGACGCGCTTCGCCGCCTATGGCTTCTGCGTTGCGCCCTTGCAGTTCAAGTGGTTCCGATTCCT
CGAACGGGCCTTTCCCATGACCAAGACGAGTGCTTTCGGTCCGGCTATGAAGCGCGTCGTCTTCGACCAGTTCGT
GTATGCACCCTTTGGTGTCGGTCTCTTCTTCGTCGCCATGACTGTCGCCGAGGGAGGCGGCAAGCGTGCCGTCAG
CAACAAGCTGAGGGACATGTACGTCCCGACGCTCAAGGCCAACTACGTCGTCTGGCCCGCCGTGCAGATGGTAAA
CTTTCGCCTGATGCCGGTGCAGTTCCAGCTGGTATGTCGTCATTTCCAAGACGTCTTTGTCTGGCTTTTGACTTT
GCTAACCCGGAACAGCCCTTCGTGTCAACCATCGGTATCGCATGGACAGCCTACCTCTCCCTCACCAACGCATCT
TCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail