Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04560
Gene name
Locationscaffold_04:3576701..3582978
Strand+
Gene length (bp)6277
Transcript length (bp)5049
Coding sequence length (bp)5049
Protein length (aa) 1683

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 4.1E-83 205 408
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 4.7E-22 742 947
PF02787 CPSase_L_D3 Carbamoyl-phosphate synthetase large chain, oligomerisation domain 2.5E-27 493 572
PF02222 ATP-grasp ATP-grasp domain 4.3E-08 214 365
PF02222 ATP-grasp ATP-grasp domain 5.7E-09 752 903
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 8.5E-08 234 375
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 2.8E-07 752 892

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0032553 ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0003824 catalytic activity No
GO:0016874 ligase activity No
GO:0003674 molecular_function No
GO:0016881 acid-amino acid ligase activity No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.096 0.0644 0.1154 0.059 0.8389 0.1576 0.0899 0.0556 0.1205 0.0141

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup176
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|267
Ophiocordyceps australis 1348a (Ghana) OphauG2|361
Ophiocordyceps australis map64 (Brazil) OphauB2|4801
Ophiocordyceps australis map64 (Brazil) OphauB2|5027
Ophiocordyceps camponoti-floridani Ophcf2|03914
Ophiocordyceps camponoti-floridani Ophcf2|04560 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6480
Ophiocordyceps camponoti-rufipedis Ophun1|7566
Ophiocordyceps kimflemingae Ophio5|6934
Ophiocordyceps kimflemingae Ophio5|7435
Ophiocordyceps subramaniannii Hirsu2|258
Ophiocordyceps subramaniannii Hirsu2|472

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04560
MLPYALAGRAPAALRIPGRGSRLGVRALHVGALGRWSSPASATQLRRFGSPRLYSLAAAPAHAAPNPQAYLKSGI
VKPKQSVEVKKVLVIGSGGLAIGQAGEFDYSGSQALKALKEAGVASVLINPNIATIQTNHELADEVYYLPVTPEY
VSYVIEREKPDGVFLSFGGQTALNLGVQMQRLGLWEKYGVKVLGTSVRTLELSEDRDLFAKALEEIKIPIAKSIA
VGTVDEALDAAEKVGYPIIVRAAYALGGLGSGFANNKEELRNMAARSLTLSPQILVEKSLKGWKELEYEVVRDAN
NNCITVCNMENFDPLGIHTGDSIVVAPSQTLSDEEYHMLRSAAIKIVRHLGVVGECNVQYALQPDGLDYRVIEVN
ARLSRSSALASKATGYPLAYTAAKIGLGHSLPELPNAVTKTTTANFEPSLDYIVTKIPRWDLSKFQHVKRDIGSA
MKSVGEVMAIGRTFEESFQKAIRQVDPRFVGFQGDKFEDLDRELQNPSDRRWLAVGQAMLHEDYSVDRVHHLTKI
DKWFLYKLQNIVDCTRELEAAGSLEALDKKYILKAKKMGFSDRQIATAVKSTEDEVRKRRLSFNIHPWVKKIDTL
AAEFPADTNYLYTTYNGSTHDVTFEDKGTAVLGSGVYRIGSSVEFDWCAVSAALALRQMGHKTIMINYNPENVST
DFDTADKLYFEELSYERVMDIYELEQASGVVVSVGGQLPQNMALRLQESGGAKVLGTDPKDIDKAEDRQKFSEML
DSIGIDQPAWKELTSVRAAEDFARQVGYPVLVRPSYVLSGAAMTVIRSKEDLKDKLEAASNVSPDHPVVISKFIE
GAQEIDVDGVASKGELVVHAISEHVEQAGVHSGDATLVLPPANLDRGTMERLKGIAQKVAKAWNITGPFNMQIIK
AEDPDGDEPVLKVIECNLRASRSFPFVSKVLGCNFIDVATKALVGSDVPEPTDLMAVKRDYLATKVPQFSWTRLA
GADPFLGVEMSSTGEIACFGKDLVEAYWTSLQSTMNFRMPEPGEGLLLGGDVSKAWLTQVVDYVAPLGYKLYAAG
QDVKRFVESSCKAKVEVRVIDFPTDDKRALREVFKKHDIRGVFNLAVARGKTTQDVDYVMRRNAVDFGVPLFMEP
QTAILFAQCMSEKLPRKGGIPSEMSLPDHHLPFPFLNQQAHPPRVNSSLNSHRTAPDIPTTGPQVSNPARMKTPV
VSSLLALSLAGCSLAAPATGDTLKPERRDVAGQTLERRDQDASEGMADMAAEAGPSHEKRQPAEGDGRSGNWWGP
GAGYGGYGGYGDDFGGYFAEKKEGKRGLDKRENGDGNSGNWWGPGAGYGGYGGYGDGYGGYFAEKKEGKRGLDKR
ENGDGNSGNWWGPGYGGPGYGDGPWGGYYAEKKEGKRGLDKRENGDGNSGNWWGPGAGYGGYGGYGDGYGDYYAE
KKEGKRGLDKRENGDGNSANWWGPGYGGYGYGDGPWGGYYAEKKESKRSVEKREENNGRTGDYWGPGAGYGGYGY
GDGPWGGYYAEKKEESKRGLDKRQPAEGEANNYWGPGVVPYGNGPFGGYFGNGYAEKKKEEKRSVEAEVRKRYDS
EGEIPAAIDDILLYAKKPNGQMSKREVEGGFDGYREGEGAVNSLVDGLFSPGRAGFSRVAKGPLAKRAVNGQQSA
AWRFGYDGYPGLVPELLEDLLRKREVAAGGFE*
Coding >Ophcf2|04560
ATGCTGCCCTACGCGCTGGCCGGTCGAGCGCCGGCTGCGCTTCGAATTCCCGGTCGAGGGTCGCGACTTGGTGTT
CGTGCTCTTCACGTCGGGGCGCTGGGACGCTGGTCGAGTCCGGCTTCGGCGACGCAGTTGAGGAGGTTCGGGAGT
CCGCGTCTTTACTCGCTTGCTGCTGCTCCTGCGCACGCGGCGCCTAATCCTCAGGCCTACCTCAAGAGCGGCATC
GTCAAGCCTAAGCAGAGCGTCGAGGTGAAAAAGGTGCTTGTTATTGGCAGTGGTGGCCTTGCCATCGGCCAGGCC
GGCGAGTTTGACTACTCTGGCTCGCAGGCTCTCAAGGCTCTCAAGGAGGCTGGCGTTGCGTCGGTGCTGATAAAC
CCCAATATTGCCACGATTCAAACCAATCATGAGCTCGCCGACGAGGTCTACTACCTACCCGTCACCCCAGAGTAC
GTTTCGTACGTGATTGAGAGGGAAAAGCCCGATGGCGTGTTTCTCTCTTTTGGTGGGCAGACGGCTCTCAACCTC
GGTGTTCAGATGCAGCGTTTGGGTCTATGGGAAAAGTACGGCGTCAAGGTTCTCGGCACCAGCGTCCGGACCCTG
GAACTGAGCGAGGATCGGGATTTGTTTGCCAAGGCTCTCGAGGAGATCAAGATACCCATCGCGAAGTCGATTGCC
GTGGGGACCGTCGATGAGGCTCTCGACGCTGCTGAAAAGGTCGGCTATCCCATCATCGTCCGCGCCGCCTACGCA
CTCGGTGGTCTCGGTTCGGGCTTTGCCAATAATAAGGAGGAGCTTCGCAACATGGCGGCTCGATCTCTTACCCTC
TCGCCGCAGATCCTGGTGGAAAAGTCGCTCAAGGGTTGGAAGGAACTCGAGTACGAGGTCGTGCGGGATGCGAAC
AACAACTGCATAACCGTTTGCAACATGGAAAACTTTGATCCCCTCGGCATTCACACCGGCGACTCTATCGTCGTG
GCGCCCAGCCAGACTCTCAGCGACGAGGAGTACCATATGCTCCGTTCAGCCGCCATCAAGATCGTCCGCCACCTC
GGCGTCGTGGGCGAATGCAACGTTCAGTACGCCTTGCAGCCGGATGGTCTCGACTACAGGGTCATCGAGGTCAAC
GCTCGCCTCTCGCGATCTTCGGCTCTGGCGTCAAAGGCCACGGGCTATCCGCTCGCCTACACGGCTGCCAAGATC
GGCCTGGGTCATAGCCTCCCGGAGCTGCCCAACGCCGTGACCAAGACGACGACGGCCAACTTTGAACCGTCGCTC
GACTACATCGTCACCAAGATTCCGCGGTGGGATCTCTCCAAGTTTCAGCACGTGAAGCGCGACATCGGCAGCGCC
ATGAAGTCTGTCGGCGAGGTCATGGCCATCGGACGCACCTTTGAGGAGTCGTTTCAAAAGGCCATTCGTCAGGTC
GATCCTCGCTTCGTGGGATTTCAGGGGGACAAGTTTGAGGACCTCGATCGTGAGCTGCAGAACCCGTCTGATCGT
CGCTGGCTCGCTGTCGGTCAGGCCATGCTCCACGAGGACTATTCGGTCGACAGGGTTCACCATCTGACCAAGATC
GACAAGTGGTTCCTCTACAAGCTGCAGAACATCGTCGACTGCACCCGCGAGCTCGAGGCCGCTGGCAGCCTCGAG
GCCCTGGACAAGAAGTACATCCTCAAGGCCAAGAAGATGGGTTTCTCGGACCGGCAGATCGCGACGGCCGTCAAG
AGCACGGAAGACGAGGTGCGTAAGCGCCGGCTGAGCTTCAACATCCACCCTTGGGTCAAGAAGATCGACACGCTG
GCTGCCGAGTTTCCGGCCGACACGAACTACCTGTACACGACCTACAACGGCTCTACGCACGACGTGACGTTTGAG
GACAAGGGTACGGCTGTCCTGGGCAGCGGCGTCTATCGCATCGGGAGCTCGGTCGAGTTCGACTGGTGTGCTGTC
AGCGCTGCGCTGGCTCTTCGGCAGATGGGACACAAGACGATTATGATTAACTACAACCCCGAGAACGTGTCGACC
GACTTCGACACGGCCGATAAGCTGTACTTTGAAGAGCTCAGCTACGAGCGCGTCATGGACATTTACGAGCTCGAG
CAGGCGTCGGGCGTCGTCGTCTCCGTCGGCGGTCAGCTGCCGCAGAACATGGCCCTTCGTTTGCAGGAGTCGGGC
GGTGCCAAGGTGTTGGGGACGGATCCGAAGGACATCGACAAGGCGGAGGATCGGCAAAAGTTCTCCGAGATGCTC
GACAGCATCGGAATCGATCAGCCGGCCTGGAAGGAGCTCACGTCGGTGCGGGCGGCCGAGGACTTTGCCCGTCAG
GTCGGATATCCGGTCCTGGTCCGGCCGAGTTACGTCCTGTCGGGTGCTGCCATGACGGTCATCAGGAGCAAGGAG
GACCTCAAGGATAAGCTCGAGGCTGCCAGCAACGTCTCGCCCGACCACCCCGTCGTCATCAGCAAGTTCATCGAG
GGCGCGCAGGAGATTGACGTCGACGGCGTCGCTTCCAAGGGTGAGCTCGTCGTTCACGCCATCAGCGAGCACGTC
GAACAGGCCGGCGTTCACTCGGGAGATGCCACGCTGGTGCTGCCGCCGGCGAATCTCGATCGGGGAACCATGGAG
CGGCTCAAGGGCATCGCTCAGAAGGTGGCCAAGGCCTGGAACATTACCGGCCCTTTCAACATGCAGATCATCAAG
GCCGAGGACCCGGACGGCGACGAGCCTGTGCTCAAGGTGATTGAATGCAACCTGCGGGCGTCGCGGTCGTTCCCC
TTTGTCAGCAAGGTGCTGGGCTGCAACTTCATCGACGTGGCCACCAAGGCGCTCGTCGGCAGCGACGTGCCCGAG
CCGACGGATCTCATGGCCGTCAAGCGCGACTACCTGGCCACAAAGGTGCCTCAATTCTCGTGGACTCGGCTGGCG
GGCGCGGATCCCTTCCTGGGGGTGGAGATGTCGTCGACGGGCGAGATTGCCTGCTTCGGAAAGGATCTCGTCGAG
GCCTACTGGACGTCTCTGCAGTCGACCATGAACTTTCGCATGCCCGAGCCCGGAGAGGGACTCTTGCTGGGCGGA
GATGTCTCCAAGGCCTGGCTCACTCAGGTGGTTGATTACGTGGCGCCCCTGGGATACAAGCTATACGCAGCCGGT
CAGGATGTGAAGCGCTTCGTCGAATCCAGCTGCAAGGCCAAGGTCGAGGTCCGGGTCATCGACTTCCCGACGGAC
GACAAGCGTGCGTTACGCGAGGTGTTTAAGAAGCATGACATTCGCGGCGTCTTCAACCTTGCCGTGGCGAGGGGG
AAGACGACGCAGGATGTCGACTACGTCATGCGTCGTAATGCTGTCGACTTTGGCGTTCCGCTGTTCATGGAGCCT
CAGACGGCTATCTTGTTTGCGCAGTGTATGAGCGAGAAACTGCCGAGGAAGGGGGGGATTCCCTCCGAGATGTCG
CTTCCGGACCATCATCTTCCTTTCCCCTTCCTCAACCAGCAAGCTCATCCACCTCGAGTCAACAGCAGCCTCAAC
AGCCATCGAACAGCACCCGACATCCCGACAACCGGACCTCAAGTTTCGAACCCAGCAAGGATGAAGACTCCCGTC
GTGAGTTCGCTCCTGGCTCTCAGCCTCGCGGGCTGCAGTCTCGCGGCGCCGGCCACCGGCGATACTCTCAAGCCC
GAGAGGCGCGACGTCGCGGGGCAGACTCTCGAGCGTCGCGATCAGGATGCTTCCGAGGGCATGGCTGACATGGCC
GCCGAGGCGGGTCCCTCGCATGAGAAGAGGCAGCCTGCTGAGGGGGACGGCAGGTCTGGGAACTGGTGGGGTCCC
GGAGCCGGTTATGGTGGTTATGGTGGTTATGGTGATGATTTCGGCGGTTACTTCGCCGAGAAGAAGGAGGGCAAA
CGAGGACTCGACAAGCGGGAGAACGGCGACGGCAACTCTGGCAACTGGTGGGGGCCCGGAGCCGGTTACGGTGGT
TACGGCGGTTATGGTGATGGTTACGGCGGTTACTTCGCCGAGAAGAAGGAGGGCAAACGAGGACTCGACAAGCGG
GAGAACGGCGACGGCAACTCTGGCAACTGGTGGGGTCCCGGCTACGGCGGTCCCGGCTACGGCGACGGGCCATGG
GGTGGTTACTATGCCGAGAAGAAGGAGGGCAAGCGAGGACTCGACAAGAGGGAGAACGGCGACGGCAACTCTGGC
AACTGGTGGGGTCCCGGAGCCGGTTACGGTGGTTACGGTGGTTATGGTGATGGTTATGGCGATTACTACGCCGAG
AAGAAGGAGGGCAAGCGAGGACTCGACAAGCGGGAGAACGGCGACGGCAACTCCGCCAACTGGTGGGGTCCCGGC
TACGGCGGTTACGGCTACGGCGACGGGCCATGGGGTGGCTACTACGCCGAGAAGAAGGAGAGCAAGAGGAGCGTC
GAGAAACGCGAGGAGAACAACGGCAGGACCGGCGACTATTGGGGTCCTGGTGCCGGTTACGGTGGTTACGGTTAC
GGTGATGGTCCCTGGGGCGGTTACTACGCCGAGAAGAAGGAGGAGAGCAAGCGTGGTCTCGACAAGCGTCAGCCT
GCAGAGGGCGAGGCCAACAACTACTGGGGTCCTGGCGTCGTTCCCTACGGCAATGGGCCCTTCGGCGGCTACTTC
GGCAACGGCTACGCCGAGAAGAAGAAGGAGGAGAAGCGGAGCGTCGAGGCCGAGGTCCGGAAACGTTATGACTCG
GAGGGTGAAATCCCCGCCGCCATCGACGACATCCTCCTCTACGCAAAGAAGCCCAACGGTCAGATGTCGAAGCGT
GAGGTTGAAGGCGGCTTCGACGGGTACAGAGAAGGCGAGGGAGCAGTCAACAGCCTAGTCGACGGCCTCTTCAGC
CCGGGCCGCGCCGGCTTCAGCCGCGTGGCCAAGGGTCCCCTGGCCAAGCGGGCCGTCAACGGCCAGCAGAGCGCC
GCCTGGCGCTTCGGCTACGACGGATACCCCGGACTCGTCCCGGAACTGCTCGAGGATCTTCTCCGTAAGCGGGAG
GTTGCGGCCGGGGGTTTCGAATAG
Transcript >Ophcf2|04560
ATGCTGCCCTACGCGCTGGCCGGTCGAGCGCCGGCTGCGCTTCGAATTCCCGGTCGAGGGTCGCGACTTGGTGTT
CGTGCTCTTCACGTCGGGGCGCTGGGACGCTGGTCGAGTCCGGCTTCGGCGACGCAGTTGAGGAGGTTCGGGAGT
CCGCGTCTTTACTCGCTTGCTGCTGCTCCTGCGCACGCGGCGCCTAATCCTCAGGCCTACCTCAAGAGCGGCATC
GTCAAGCCTAAGCAGAGCGTCGAGGTGAAAAAGGTGCTTGTTATTGGCAGTGGTGGCCTTGCCATCGGCCAGGCC
GGCGAGTTTGACTACTCTGGCTCGCAGGCTCTCAAGGCTCTCAAGGAGGCTGGCGTTGCGTCGGTGCTGATAAAC
CCCAATATTGCCACGATTCAAACCAATCATGAGCTCGCCGACGAGGTCTACTACCTACCCGTCACCCCAGAGTAC
GTTTCGTACGTGATTGAGAGGGAAAAGCCCGATGGCGTGTTTCTCTCTTTTGGTGGGCAGACGGCTCTCAACCTC
GGTGTTCAGATGCAGCGTTTGGGTCTATGGGAAAAGTACGGCGTCAAGGTTCTCGGCACCAGCGTCCGGACCCTG
GAACTGAGCGAGGATCGGGATTTGTTTGCCAAGGCTCTCGAGGAGATCAAGATACCCATCGCGAAGTCGATTGCC
GTGGGGACCGTCGATGAGGCTCTCGACGCTGCTGAAAAGGTCGGCTATCCCATCATCGTCCGCGCCGCCTACGCA
CTCGGTGGTCTCGGTTCGGGCTTTGCCAATAATAAGGAGGAGCTTCGCAACATGGCGGCTCGATCTCTTACCCTC
TCGCCGCAGATCCTGGTGGAAAAGTCGCTCAAGGGTTGGAAGGAACTCGAGTACGAGGTCGTGCGGGATGCGAAC
AACAACTGCATAACCGTTTGCAACATGGAAAACTTTGATCCCCTCGGCATTCACACCGGCGACTCTATCGTCGTG
GCGCCCAGCCAGACTCTCAGCGACGAGGAGTACCATATGCTCCGTTCAGCCGCCATCAAGATCGTCCGCCACCTC
GGCGTCGTGGGCGAATGCAACGTTCAGTACGCCTTGCAGCCGGATGGTCTCGACTACAGGGTCATCGAGGTCAAC
GCTCGCCTCTCGCGATCTTCGGCTCTGGCGTCAAAGGCCACGGGCTATCCGCTCGCCTACACGGCTGCCAAGATC
GGCCTGGGTCATAGCCTCCCGGAGCTGCCCAACGCCGTGACCAAGACGACGACGGCCAACTTTGAACCGTCGCTC
GACTACATCGTCACCAAGATTCCGCGGTGGGATCTCTCCAAGTTTCAGCACGTGAAGCGCGACATCGGCAGCGCC
ATGAAGTCTGTCGGCGAGGTCATGGCCATCGGACGCACCTTTGAGGAGTCGTTTCAAAAGGCCATTCGTCAGGTC
GATCCTCGCTTCGTGGGATTTCAGGGGGACAAGTTTGAGGACCTCGATCGTGAGCTGCAGAACCCGTCTGATCGT
CGCTGGCTCGCTGTCGGTCAGGCCATGCTCCACGAGGACTATTCGGTCGACAGGGTTCACCATCTGACCAAGATC
GACAAGTGGTTCCTCTACAAGCTGCAGAACATCGTCGACTGCACCCGCGAGCTCGAGGCCGCTGGCAGCCTCGAG
GCCCTGGACAAGAAGTACATCCTCAAGGCCAAGAAGATGGGTTTCTCGGACCGGCAGATCGCGACGGCCGTCAAG
AGCACGGAAGACGAGGTGCGTAAGCGCCGGCTGAGCTTCAACATCCACCCTTGGGTCAAGAAGATCGACACGCTG
GCTGCCGAGTTTCCGGCCGACACGAACTACCTGTACACGACCTACAACGGCTCTACGCACGACGTGACGTTTGAG
GACAAGGGTACGGCTGTCCTGGGCAGCGGCGTCTATCGCATCGGGAGCTCGGTCGAGTTCGACTGGTGTGCTGTC
AGCGCTGCGCTGGCTCTTCGGCAGATGGGACACAAGACGATTATGATTAACTACAACCCCGAGAACGTGTCGACC
GACTTCGACACGGCCGATAAGCTGTACTTTGAAGAGCTCAGCTACGAGCGCGTCATGGACATTTACGAGCTCGAG
CAGGCGTCGGGCGTCGTCGTCTCCGTCGGCGGTCAGCTGCCGCAGAACATGGCCCTTCGTTTGCAGGAGTCGGGC
GGTGCCAAGGTGTTGGGGACGGATCCGAAGGACATCGACAAGGCGGAGGATCGGCAAAAGTTCTCCGAGATGCTC
GACAGCATCGGAATCGATCAGCCGGCCTGGAAGGAGCTCACGTCGGTGCGGGCGGCCGAGGACTTTGCCCGTCAG
GTCGGATATCCGGTCCTGGTCCGGCCGAGTTACGTCCTGTCGGGTGCTGCCATGACGGTCATCAGGAGCAAGGAG
GACCTCAAGGATAAGCTCGAGGCTGCCAGCAACGTCTCGCCCGACCACCCCGTCGTCATCAGCAAGTTCATCGAG
GGCGCGCAGGAGATTGACGTCGACGGCGTCGCTTCCAAGGGTGAGCTCGTCGTTCACGCCATCAGCGAGCACGTC
GAACAGGCCGGCGTTCACTCGGGAGATGCCACGCTGGTGCTGCCGCCGGCGAATCTCGATCGGGGAACCATGGAG
CGGCTCAAGGGCATCGCTCAGAAGGTGGCCAAGGCCTGGAACATTACCGGCCCTTTCAACATGCAGATCATCAAG
GCCGAGGACCCGGACGGCGACGAGCCTGTGCTCAAGGTGATTGAATGCAACCTGCGGGCGTCGCGGTCGTTCCCC
TTTGTCAGCAAGGTGCTGGGCTGCAACTTCATCGACGTGGCCACCAAGGCGCTCGTCGGCAGCGACGTGCCCGAG
CCGACGGATCTCATGGCCGTCAAGCGCGACTACCTGGCCACAAAGGTGCCTCAATTCTCGTGGACTCGGCTGGCG
GGCGCGGATCCCTTCCTGGGGGTGGAGATGTCGTCGACGGGCGAGATTGCCTGCTTCGGAAAGGATCTCGTCGAG
GCCTACTGGACGTCTCTGCAGTCGACCATGAACTTTCGCATGCCCGAGCCCGGAGAGGGACTCTTGCTGGGCGGA
GATGTCTCCAAGGCCTGGCTCACTCAGGTGGTTGATTACGTGGCGCCCCTGGGATACAAGCTATACGCAGCCGGT
CAGGATGTGAAGCGCTTCGTCGAATCCAGCTGCAAGGCCAAGGTCGAGGTCCGGGTCATCGACTTCCCGACGGAC
GACAAGCGTGCGTTACGCGAGGTGTTTAAGAAGCATGACATTCGCGGCGTCTTCAACCTTGCCGTGGCGAGGGGG
AAGACGACGCAGGATGTCGACTACGTCATGCGTCGTAATGCTGTCGACTTTGGCGTTCCGCTGTTCATGGAGCCT
CAGACGGCTATCTTGTTTGCGCAGTGTATGAGCGAGAAACTGCCGAGGAAGGGGGGGATTCCCTCCGAGATGTCG
CTTCCGGACCATCATCTTCCTTTCCCCTTCCTCAACCAGCAAGCTCATCCACCTCGAGTCAACAGCAGCCTCAAC
AGCCATCGAACAGCACCCGACATCCCGACAACCGGACCTCAAGTTTCGAACCCAGCAAGGATGAAGACTCCCGTC
GTGAGTTCGCTCCTGGCTCTCAGCCTCGCGGGCTGCAGTCTCGCGGCGCCGGCCACCGGCGATACTCTCAAGCCC
GAGAGGCGCGACGTCGCGGGGCAGACTCTCGAGCGTCGCGATCAGGATGCTTCCGAGGGCATGGCTGACATGGCC
GCCGAGGCGGGTCCCTCGCATGAGAAGAGGCAGCCTGCTGAGGGGGACGGCAGGTCTGGGAACTGGTGGGGTCCC
GGAGCCGGTTATGGTGGTTATGGTGGTTATGGTGATGATTTCGGCGGTTACTTCGCCGAGAAGAAGGAGGGCAAA
CGAGGACTCGACAAGCGGGAGAACGGCGACGGCAACTCTGGCAACTGGTGGGGGCCCGGAGCCGGTTACGGTGGT
TACGGCGGTTATGGTGATGGTTACGGCGGTTACTTCGCCGAGAAGAAGGAGGGCAAACGAGGACTCGACAAGCGG
GAGAACGGCGACGGCAACTCTGGCAACTGGTGGGGTCCCGGCTACGGCGGTCCCGGCTACGGCGACGGGCCATGG
GGTGGTTACTATGCCGAGAAGAAGGAGGGCAAGCGAGGACTCGACAAGAGGGAGAACGGCGACGGCAACTCTGGC
AACTGGTGGGGTCCCGGAGCCGGTTACGGTGGTTACGGTGGTTATGGTGATGGTTATGGCGATTACTACGCCGAG
AAGAAGGAGGGCAAGCGAGGACTCGACAAGCGGGAGAACGGCGACGGCAACTCCGCCAACTGGTGGGGTCCCGGC
TACGGCGGTTACGGCTACGGCGACGGGCCATGGGGTGGCTACTACGCCGAGAAGAAGGAGAGCAAGAGGAGCGTC
GAGAAACGCGAGGAGAACAACGGCAGGACCGGCGACTATTGGGGTCCTGGTGCCGGTTACGGTGGTTACGGTTAC
GGTGATGGTCCCTGGGGCGGTTACTACGCCGAGAAGAAGGAGGAGAGCAAGCGTGGTCTCGACAAGCGTCAGCCT
GCAGAGGGCGAGGCCAACAACTACTGGGGTCCTGGCGTCGTTCCCTACGGCAATGGGCCCTTCGGCGGCTACTTC
GGCAACGGCTACGCCGAGAAGAAGAAGGAGGAGAAGCGGAGCGTCGAGGCCGAGGTCCGGAAACGTTATGACTCG
GAGGGTGAAATCCCCGCCGCCATCGACGACATCCTCCTCTACGCAAAGAAGCCCAACGGTCAGATGTCGAAGCGT
GAGGTTGAAGGCGGCTTCGACGGGTACAGAGAAGGCGAGGGAGCAGTCAACAGCCTAGTCGACGGCCTCTTCAGC
CCGGGCCGCGCCGGCTTCAGCCGCGTGGCCAAGGGTCCCCTGGCCAAGCGGGCCGTCAACGGCCAGCAGAGCGCC
GCCTGGCGCTTCGGCTACGACGGATACCCCGGACTCGTCCCGGAACTGCTCGAGGATCTTCTCCGTAAGCGGGAG
GTTGCGGCCGGGGGTTTCGAATAG
Gene >Ophcf2|04560
ATGCTGCCCTACGCGCTGGCCGGTCGAGCGCCGGCTGCGCTTCGAATTCCCGGTCGAGGGTCGCGACTTGGTGTT
CGTGCTCTTCACGTCGGGGCGCTGGGACGCTGGTCGAGTCCGGCTTCGGCGACGCAGTTGAGGAGGTTCGGGAGT
CCGCGTCTTTACTCGCTTGCTGCTGCTCCTGCGCACGCGGCGCCTAATCCTCAGGCCTACCTCAAGAGCGGCATC
GTCAAGCCTAAGCAGAGCGTCGAGGTGAAAAAGGTGCTTGTTATTGGCAGTGGTGGCCTTGCCATCGGCCAGGCC
GGCGAGTTTGACTACTCTGGTTCGCTTGCGGCTTTTCCCTTTTGGCAATTCTCTTCTTTGACTGATGGGTTTTTT
TTTCTTTCTGGCAGGCTCGCAGGCTCTCAAGGCTCTCAAGGAGGCTGGCGTTGCGTCGGTGCTGATAAACCCCAA
TATTGCCACGATTCAAACCAATCATGAGCTCGCCGACGAGGTCTACTACCTACCCGTCACCCCAGAGTACGTTTC
GTACGTGATTGAGAGGGAAAAGCCCGATGGCGTGTTTCTCTCTTTTGGTGGGCAGACGGCTCTCAACCTCGGTGT
TCAGATGCAGCGTTTGGGTCTATGGGAAAAGTACGGCGTCAAGGTTCTCGGCACCAGCGTCCGGACCCTGGAACT
GAGCGAGGATCGGGATTTGTTTGCCAAGGCTCTCGAGGAGATCAAGATACCCATCGCGAAGTCGATTGCCGTGGG
GACCGTCGATGAGGCTCTCGACGCTGCTGAAAAGGTCGGCTATCCCATCATCGTCCGCGCCGCCTACGCACTCGG
TGGTCTCGGTTCGGGCTTTGCCAATAATAAGGAGGAGCTTCGCAACATGGCGGCTCGATCTCTTACCCTCTCGCC
GCAGATCCTGGTGGAAAAGTCGCTCAAGGGTTGGAAGGAACTCGAGTACGAGGTCGTGCGGGATGCGAACAACAA
CTGCATAACCGTTTGCAACATGGAAAACTTTGATCCCCTCGGCATTCACACCGGCGACTCTATCGTCGTGGCGCC
CAGCCAGACTCTCAGCGACGAGGAGTACCATATGCTCCGTTCAGCCGCCATCAAGATCGTCCGCCACCTCGGCGT
CGTGGGCGAATGCAACGTTCAGTACGCCTTGCAGCCGGATGGTCTCGACTACAGGGTCATCGAGGTCAACGCTCG
CCTCTCGCGATCTTCGGCTCTGGCGTCAAAGGCCACGGGCTATCCGCTCGCCTACACGGCTGCCAAGATCGGCCT
GGGTCATAGCCTCCCGGAGCTGCCCAACGCCGTGACCAAGACGACGACGGCCAACTTTGAACCGTCGCTCGACTA
CATCGTCACCAAGATTCCGCGGTGGGATCTCTCCAAGTTTCAGCACGTGAAGCGCGACATCGGCAGCGCCATGAA
GTCTGTCGGCGAGGTCATGGCCATCGGACGCACCTTTGAGGAGTCGTTTCAAAAGGCCATTCGTCAGGTCGATCC
TCGCTTCGTGGGATTTCAGGGGGACAAGTTTGAGGACCTCGATCGTGAGCTGCAGAACCCGTCTGATCGTCGCTG
GCTCGCTGTCGGTCAGGCCATGCTCCACGAGGACTATTCGGTCGACAGGGTTCACCATCTGACCAAGATCGACAA
GTGGTTCCTCTACAAGCTGCAGAACATCGTCGACTGCACCCGCGAGCTCGAGGCCGCTGGCAGCCTCGAGGCCCT
GGACAAGAAGTACATCCTCAAGGCCAAGAAGATGGGTTTCTCGGACCGGCAGATCGCGACGGCCGTCAAGAGCAC
GGAAGACGAGGTGCGTAAGCGCCGGCTGAGCTTCAACATCCACCCTTGGGTCAAGAAGATCGACACGCTGGCTGC
CGAGTTTCCGGCCGACACGAACTACCTGTACACGACCTACAACGGCTCTACGCACGACGTGACGTTTGAGGACAA
GGGTACGGCTGTCCTGGGCAGCGGCGTCTATCGCATCGGGAGCTCGGTCGAGTTCGACTGGTGTGCTGTCAGCGC
TGCGCTGGCTCTTCGGCAGATGGGACACAAGACGATTATGATTAACGCGAGTTGGACCGCTGCTTTTGTCCCCGT
GACGAAGGTGACGGAGTGCTGACTCGTTTGTTCTTTGATAGTACAACCCCGAGAACGTGTCGACCGACTTCGACA
CGGCCGATAAGCTGTACTTTGAAGAGCTCAGCTACGAGCGCGTCATGGACATTTACGAGCTCGAGCAGGCGTCGG
GCGTCGTCGTCTCCGTCGGCGGTCAGCTGCCGCAGAACATGGCCCTTCGTTTGCAGGAGTCGGGCGGTGCCAAGG
TGTTGGGGACGGATCCGAAGGACATCGACAAGGCGGAGGATCGGCAAAAGTTCTCCGAGATGCTCGACAGCATCG
GAATCGATCAGCCGGCCTGGAAGGAGCTCACGTCGGTGCGGGCGGCCGAGGACTTTGCCCGTCAGGTCGGATATC
CGGTCCTGGTCCGGCCGAGTTACGTCCTGTCGGGTGCTGCCATGACGGTCATCAGGAGCAAGGAGGACCTCAAGG
ATAAGCTCGAGGCTGCCAGCAACGTCTCGCCCGACCACCCCGTCGTCATCAGCAAGTTCATCGAGGGCGCGCAGG
AGATTGACGTCGACGGCGTCGCTTCCAAGGGTGAGCTCGTCGTTCACGCCATCAGCGAGCACGTCGAACAGGCCG
GCGTTCACTCGGGAGATGCCACGCTGGTGCTGCCGCCGGCGAATCTCGATCGGGGAACCATGGAGCGGCTCAAGG
GCATCGCTCAGAAGGTGGCCAAGGCCTGGAACATTACCGGCCCTTTCAACATGCAGATCATCAAGGCCGAGGACC
CGGACGGCGACGAGCCTGTGCTCAAGGTGATTGAATGCAACCTGCGGGCGTCGCGGTCGTTCCCCTTTGTCAGCA
AGGTGCTGGGCTGCAACTTCATCGACGTGGCCACCAAGGCGCTCGTCGGCAGCGACGTGCCCGAGCCGACGGATC
TCATGGCCGTCAAGCGCGACTACCTGGCCACAAAGGTGCCTCAATTCTCGTGGACTCGGCTGGCGGGCGCGGATC
CCTTCCTGGGGGTGGAGATGTCGTCGACGGGCGAGATTGCCTGCTTCGGAAAGGATCTCGTCGAGGCCTACTGGA
CGTCTCTGCAGTCGACCATGAACTTTCGCATGCCCGAGCCCGGAGAGGGACTCTTGCTGGGCGGAGATGTCTCCA
AGGCCTGGCTCACTCAGGTGGTTGATTACGTGGCGCCCCTGGGATACAAGCTATACGCAGCCGGTCAGGATGTGA
AGCGCTTCGTCGAATCCAGCTGCAAGGCCAAGGTCGAGGTCCGGGTCATCGACTTCCCGACGGACGACAAGCGTG
CGTTACGCGAGGTGTTTAAGAAGCATGACATTCGCGGCGTCTTCAACCTTGCCGTGGCGAGGGGGAAGACGACGC
AGGATGTCGACTACGTCATGCGTCGTAATGCTGTCGACTTTGGCGTTCCGCTGTTCATGGAGCCTCAGGTGAGAG
ACCTCTCTGCCGTGCTTGGTTTCGTGTCTTTTTGACTGATTGGGGTTTCCTCGCAGACGGCTATCTTGTTTGCGC
AGTGTATGAGCGAGAAACTGCCGAGGAAGGGGGGGATTCCCTCCGAGGTGAAGAGGTGGTCTGAATTCATCGGTG
GGAAACCACTGTGATGTTGGCGAAACTCGGGACTCGTTCCCCCCTCACACTTCTTCTCACGGAGCAAGGAAAAAA
AAAAAAAAAACAAAAAAAAAACAACAACAACAACAAAAAAACAAAATCGAAGCCGGCGTTGGCGTTGCCTGGCTT
AATGTCTTTGATATGTTGCATCACTGAGCCTGTCCTTTCCCTGCTTTGTCTGCCATGTTCTGAGGGGAAGCTGGG
CTTGTTGTTGCCTGAGGAGGTTTGTGAAGGGGGTGAAAATGATGGTGGCTTGTATGTATGACTGGTATAGAGGTC
GGTCAATTGACGGTTTTTTGATGTTGGCCTCGGCGGAGGAAGAGTCCGAGGTAAGTTACGTGGCCTTGTTGACAC
TGAAAAGGTCGGAGCCCATCACGGACAAATGTCAGTCTCTCAATGACAGCTGGTTGGTGGCTTCGAAGCAAAGTC
TGCCGAGATGACAACGGCTCACGCGCACGACTCATCCCCATAGCTAGAAAGAGGAACGAAGATGCCGAGCAACCC
CTACGATGCCCGCGAGTCCCGTGCCGACGCCGCCCAGACCGTAAGTCAACACGGCCGTTGGCCAACTCATTCCCC
CGTCAGGCGGGCCGCACCGCCCCAACCTTCAGGTTTCCTCCTTGTCGAGGGAACGAGGACAGCGCCACAAGATGA
TTACTACAGCCGTGGAATCCGCCTTTTGAACCTCCCCCCCCCCTTCCTGACAGCTATGACGAAGGTCTGGACAGG
GCGAATTCCCGGGCTTTGGAACGCGACGATGCCTCCTTTTTTGGGGATGCGTTGCTTCTCTCGAGCCACAGTTCT
CAGGGGTTGCTGGGAGGTGAGAGATGGGACTGGATCTGATGTTTGGTGGAATGGTGGGATGGGGGGTGTTGAAGT
GTTGATGCTTCCCTCGCGTCAGTCTCGTCGCGTATAAGATGTCGCTTCCGGACCATCATCTTCCTTTCCCCTTCC
TCAACCAGCAAGCTCATCCACCTCGAGTCAACAGCAGCCTCAACAGCCATCGAACAGCACCCGACATCCCGACAA
CCGGACCTCAAGTTTCGAACCCAGCAAGGATGAAGACTCCCGTCGTGAGTTCGCTCCTGGCTCTCAGCCTCGCGG
GCTGCAGTCTCGCGGCGCCGGCCACCGGCGATACTCTCAAGCCCGAGAGGCGCGACGTCGCGGGGCAGACTCTCG
AGCGTCGCGATCAGGATGCTTCCGAGGGCATGGCTGACATGGCCGCCGAGGCGGGTCCCTCGCATGAGAAGAGGC
AGCCTGCTGAGGGGGACGGCAGGTCTGGGAACTGGTGGGGTCCCGGAGCCGGTTATGGTGGTTATGGTGGTTATG
GTGATGATTTCGGCGGTTACTTCGCCGAGAAGAAGGAGGGCAAACGAGGACTCGACAAGCGGGAGAACGGCGACG
GCAACTCTGGCAACTGGTGGGGGCCCGGAGCCGGTTACGGTGGTTACGGCGGTTATGGTGATGGTTACGGCGGTT
ACTTCGCCGAGAAGAAGGAGGGCAAACGAGGACTCGACAAGCGGGAGAACGGCGACGGCAACTCTGGCAACTGGT
GGGGTCCCGGCTACGGCGGTCCCGGCTACGGCGACGGGCCATGGGGTGGTTACTATGCCGAGAAGAAGGAGGGCA
AGCGAGGACTCGACAAGAGGGAGAACGGCGACGGCAACTCTGGCAACTGGTGGGGTCCCGGAGCCGGTTACGGTG
GTTACGGTGGTTATGGTGATGGTTATGGCGATTACTACGCCGAGAAGAAGGAGGGCAAGCGAGGACTCGACAAGC
GGGAGAACGGCGACGGCAACTCCGCCAACTGGTGGGGTCCCGGCTACGGCGGTTACGGCTACGGCGACGGGCCAT
GGGGTGGCTACTACGCCGAGAAGAAGGAGAGCAAGAGGAGCGTCGAGAAACGCGAGGAGAACAACGGCAGGACCG
GCGACTATTGGGGTCCTGGTGCCGGTTACGGTGGTTACGGTTACGGTGATGGTCCCTGGGGCGGTTACTACGCCG
AGAAGAAGGAGGAGAGCAAGCGTGGTCTCGACAAGCGTCAGCCTGCAGAGGGCGAGGCCAACAACTACTGGGGTC
CTGGCGTCGTTCCCTACGGCAATGGGCCCTTCGGCGGCTACTTCGGCAACGGCTACGCCGAGAAGAAGAAGGAGG
AGAAGCGGAGCGTCGAGGCCGAGGTCCGGAAACGTTATGACTCGGAGGGTGAAATCCCCGCCGCCATCGACGACA
TCCTCCTCTACGCAAAGAAGCCCAACGGTCAGATGTCGAAGCGTGAGGTTGAAGGCGGCTTCGACGGGTACAGAG
AAGGCGAGGGAGCAGTCAACAGCCTAGTCGACGGCCTCTTCAGCCCGGGCCGCGCCGGCTTCAGCCGCGTGGCCA
AGGGTCCCCTGGCCAAGCGGGCCGTCAACGGCCAGCAGAGCGCCGCCTGGCGCTTCGGCTACGACGGATACCCCG
GACTCGTCCCGGAACTGCTCGAGGATCTTCTCCGTAAGCGGGAGGTTGCGGCCGGTACGGACATCCTTGACGAGG
CGACTGTGGCGAGGGAGGCTTTGGCTGATGTTGTGCAGGGGGTTTCGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail