Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04555
Gene name
Locationscaffold_04:3562871..3565318
Strand+
Gene length (bp)2447
Transcript length (bp)1845
Coding sequence length (bp)1845
Protein length (aa) 615

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00855 PWWP PWWP domain 3.8E-14 136 242
PF08711 Med26 TFIIS helical bundle-like domain 3.4E-04 425 476

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2728 0.8024 0.3153 0.0867 0.0333 0.0056 0.018 0.0068 0.0144 0.0003

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3521
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4222
Ophiocordyceps australis map64 (Brazil) OphauB2|1853
Ophiocordyceps camponoti-floridani Ophcf2|04555 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4479
Ophiocordyceps kimflemingae Ophio5|859
Ophiocordyceps subramaniannii Hirsu2|6748

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04555
MADKPTDKPASIDKAATPTPQGDGQEVGEKEASNDGGATKLAEAEEAPDKTEAAADDQEAVEKPSAQEGKEHEKA
DADVEMKDAAEEPAAPEPGPVVSVKTKGAGRRKSSLGEAKGKTLAKKASKARLSHVDAKPGDHFLVKLKGHPAWP
AIVCDETMLPAALISSRPVSAARSDGSYAEAYADGGKRVHDRSFPVMYLYTNEFGWAQNSTLSKLTAEKAKDTIT
EKMRKDLRAAYELAAEHNDVDHYKEILQSFQEEQIAQEEARKQTVTLKRAKKGKGKALDDDDDLDIEMDDANVIP
KSAKSKKRKAEDDTSTPQRPDSVKKPKIKLNTSSTPKTANGAATPKSAGASAAKGSKSKPKKAKDGGDKKAETPK
EAKMTPEERRARKEKEVLYLRHKLQRGLLTREQQPREDEMKTMSDFVTVLENMVDLEVSIIRATKINKVLKAILK
LDSIPREEDFEFKKRSQSLLDKWNKLLADDGSGATTAPTNGVNGAAEEKKGKAANGVKDDAREAPKADSDKDEPD
KTEEKGGEEDSVAKDSAAEDKAEGAVEDKAEAAEEKTETAEEKTETAEKKTEPAEDKAEEAVEEAVEETDKKAVK
EATPAADVASDAEN*
Coding >Ophcf2|04555
ATGGCCGACAAGCCGACGGATAAGCCGGCGTCCATCGACAAGGCTGCGACGCCGACGCCTCAGGGGGACGGGCAG
GAGGTGGGAGAGAAGGAGGCTTCCAACGACGGAGGCGCGACTAAGCTTGCAGAAGCCGAGGAGGCCCCCGACAAA
ACAGAGGCTGCCGCCGACGACCAAGAGGCTGTCGAGAAACCATCTGCTCAAGAGGGAAAGGAGCACGAAAAGGCC
GACGCCGACGTCGAGATGAAAGACGCTGCCGAGGAACCGGCGGCTCCCGAGCCTGGGCCCGTCGTCTCTGTCAAA
ACCAAAGGCGCTGGTCGTCGCAAGTCGAGCCTCGGGGAGGCCAAGGGCAAGACGTTGGCCAAGAAGGCATCCAAG
GCACGTCTCAGCCACGTCGACGCGAAACCCGGCGACCACTTCCTCGTCAAACTCAAGGGCCATCCCGCCTGGCCC
GCCATCGTGTGCGACGAGACCATGCTGCCCGCTGCTCTCATCAGCAGCCGTCCCGTCTCGGCTGCCAGGTCAGAC
GGAAGCTATGCCGAAGCTTATGCCGACGGAGGCAAGCGTGTCCACGACAGAAGCTTCCCCGTCATGTACCTCTAC
ACCAACGAGTTTGGATGGGCTCAAAACTCGACTCTCTCGAAACTCACGGCTGAAAAGGCCAAGGACACCATCACG
GAAAAGATGCGCAAGGACCTCAGGGCCGCGTACGAGCTCGCCGCCGAACACAACGACGTCGATCACTACAAGGAG
ATACTCCAGTCCTTCCAGGAGGAGCAGATTGCACAGGAAGAGGCCAGAAAGCAGACCGTCACCCTCAAAAGGGCC
AAGAAGGGCAAGGGTAAGGCTCTCGACGACGATGACGACCTCGACATCGAAATGGATGATGCCAACGTCATTCCC
AAGTCGGCCAAATCTAAGAAGCGGAAGGCCGAGGACGACACCAGCACTCCTCAGAGACCCGACTCGGTCAAGAAG
CCCAAGATCAAGCTCAACACGTCGTCGACTCCCAAGACGGCCAACGGCGCCGCCACGCCCAAGTCGGCCGGTGCT
TCTGCCGCCAAGGGCTCCAAGTCGAAGCCTAAGAAGGCCAAAGACGGGGGCGACAAGAAGGCGGAGACGCCCAAG
GAGGCTAAGATGACTCCCGAGGAGCGCAGGGCTCGGAAAGAGAAAGAGGTTCTCTACCTCCGTCACAAGCTCCAG
CGGGGCCTCCTTACCAGGGAGCAGCAGCCGCGGGAGGACGAGATGAAGACCATGTCGGACTTCGTCACGGTCCTC
GAGAACATGGTCGACCTCGAGGTCTCCATCATCAGGGCGACCAAGATCAACAAGGTGCTCAAGGCCATCCTCAAG
CTCGACTCGATCCCCCGCGAGGAGGACTTTGAGTTCAAAAAGAGATCGCAGTCGCTGCTCGACAAGTGGAACAAG
CTGCTCGCCGACGATGGCTCCGGTGCCACGACGGCTCCGACCAACGGCGTCAACGGGGCGGCCGAGGAGAAGAAG
GGCAAGGCCGCCAATGGCGTCAAGGACGACGCCCGCGAGGCCCCCAAGGCCGACTCGGACAAGGACGAACCCGAC
AAGACTGAGGAGAAGGGCGGCGAGGAAGACTCGGTCGCCAAGGACTCGGCCGCCGAGGACAAGGCGGAAGGTGCT
GTCGAAGACAAGGCCGAGGCTGCCGAGGAGAAGACGGAGACGGCCGAGGAGAAGACGGAGACGGCCGAGAAGAAG
ACGGAGCCGGCCGAGGACAAGGCAGAGGAGGCCGTCGAGGAGGCCGTCGAGGAGACCGACAAGAAGGCCGTCAAG
GAAGCGACTCCCGCAGCGGACGTTGCGTCGGATGCGGAAAATTGA
Transcript >Ophcf2|04555
ATGGCCGACAAGCCGACGGATAAGCCGGCGTCCATCGACAAGGCTGCGACGCCGACGCCTCAGGGGGACGGGCAG
GAGGTGGGAGAGAAGGAGGCTTCCAACGACGGAGGCGCGACTAAGCTTGCAGAAGCCGAGGAGGCCCCCGACAAA
ACAGAGGCTGCCGCCGACGACCAAGAGGCTGTCGAGAAACCATCTGCTCAAGAGGGAAAGGAGCACGAAAAGGCC
GACGCCGACGTCGAGATGAAAGACGCTGCCGAGGAACCGGCGGCTCCCGAGCCTGGGCCCGTCGTCTCTGTCAAA
ACCAAAGGCGCTGGTCGTCGCAAGTCGAGCCTCGGGGAGGCCAAGGGCAAGACGTTGGCCAAGAAGGCATCCAAG
GCACGTCTCAGCCACGTCGACGCGAAACCCGGCGACCACTTCCTCGTCAAACTCAAGGGCCATCCCGCCTGGCCC
GCCATCGTGTGCGACGAGACCATGCTGCCCGCTGCTCTCATCAGCAGCCGTCCCGTCTCGGCTGCCAGGTCAGAC
GGAAGCTATGCCGAAGCTTATGCCGACGGAGGCAAGCGTGTCCACGACAGAAGCTTCCCCGTCATGTACCTCTAC
ACCAACGAGTTTGGATGGGCTCAAAACTCGACTCTCTCGAAACTCACGGCTGAAAAGGCCAAGGACACCATCACG
GAAAAGATGCGCAAGGACCTCAGGGCCGCGTACGAGCTCGCCGCCGAACACAACGACGTCGATCACTACAAGGAG
ATACTCCAGTCCTTCCAGGAGGAGCAGATTGCACAGGAAGAGGCCAGAAAGCAGACCGTCACCCTCAAAAGGGCC
AAGAAGGGCAAGGGTAAGGCTCTCGACGACGATGACGACCTCGACATCGAAATGGATGATGCCAACGTCATTCCC
AAGTCGGCCAAATCTAAGAAGCGGAAGGCCGAGGACGACACCAGCACTCCTCAGAGACCCGACTCGGTCAAGAAG
CCCAAGATCAAGCTCAACACGTCGTCGACTCCCAAGACGGCCAACGGCGCCGCCACGCCCAAGTCGGCCGGTGCT
TCTGCCGCCAAGGGCTCCAAGTCGAAGCCTAAGAAGGCCAAAGACGGGGGCGACAAGAAGGCGGAGACGCCCAAG
GAGGCTAAGATGACTCCCGAGGAGCGCAGGGCTCGGAAAGAGAAAGAGGTTCTCTACCTCCGTCACAAGCTCCAG
CGGGGCCTCCTTACCAGGGAGCAGCAGCCGCGGGAGGACGAGATGAAGACCATGTCGGACTTCGTCACGGTCCTC
GAGAACATGGTCGACCTCGAGGTCTCCATCATCAGGGCGACCAAGATCAACAAGGTGCTCAAGGCCATCCTCAAG
CTCGACTCGATCCCCCGCGAGGAGGACTTTGAGTTCAAAAAGAGATCGCAGTCGCTGCTCGACAAGTGGAACAAG
CTGCTCGCCGACGATGGCTCCGGTGCCACGACGGCTCCGACCAACGGCGTCAACGGGGCGGCCGAGGAGAAGAAG
GGCAAGGCCGCCAATGGCGTCAAGGACGACGCCCGCGAGGCCCCCAAGGCCGACTCGGACAAGGACGAACCCGAC
AAGACTGAGGAGAAGGGCGGCGAGGAAGACTCGGTCGCCAAGGACTCGGCCGCCGAGGACAAGGCGGAAGGTGCT
GTCGAAGACAAGGCCGAGGCTGCCGAGGAGAAGACGGAGACGGCCGAGGAGAAGACGGAGACGGCCGAGAAGAAG
ACGGAGCCGGCCGAGGACAAGGCAGAGGAGGCCGTCGAGGAGGCCGTCGAGGAGACCGACAAGAAGGCCGTCAAG
GAAGCGACTCCCGCAGCGGACGTTGCGTCGGATGCGGAAAATTGA
Gene >Ophcf2|04555
ATGGCCGACAAGCCGACGGATAAGCCGGCGTCCATCGACAAGGCTGCGACGCCGACGCCTCAGGGGGACGGGCAG
GAGGTGGGAGAGAAGGAGGCTTCCAACGACGGAGGCGCGACTAAGCTTGCAGGTGAGTTTTGGCGGTGCACGTCT
GACGCGTCGTGTTTCCTCTAATCTCGACTGTCCCATCTTTGTCTTTGCTTTCTGCCTTGTTCTTTTCTGTCCTTC
CTTTCTTTTCGCTCGGTTCAATCTCTTGCTTGTTGCAGATCCACCTTTTGTCCTGGCGGTTTTGCGGCCAATTCG
AGTGGGAAAATTCTGCATCTGTTTACGAAAACCCCCTCCCACCTCACCTCGCCTTTGTTACCTCATTCCCCCTTT
TTGCGCTCGAGACGATCCTCTCCCTTCTGTGCGGCTGCAGTCACGACGCTGACGACGCCATCGATTAGAAGCCGA
GGAGGCCCCCGACAAAACAGAGGCTGCCGCCGACGACCAAGAGGCTGTCGAGAAACCATCTGCTCAAGAGGGAAA
GGAGCACGAAAAGGCCGACGCCGACGTCGAGATGAAAGACGCTGCCGAGGAACCGGCGGCTCCCGAGCCTGGGCC
CGTCGTCTCTGTCAAAACCAAAGGCGCTGGTCGTCGCAAGTCGAGCCTCGGGGAGGCCAAGGGCAAGACGTTGGC
CAAGAAGGCATCCAAGGCACGTCTCAGCCACGTCGACGCGAAACCCGGCGACCACTTCCTCGTCAAACTCAAGGG
CCATCCCGCCTGGCCCGCCATCGTGTGCGACGAGACCATGCTGCCCGCTGCTCTCATCAGCAGCCGTCCCGTCTC
GGCTGCCAGGTCAGACGGAAGCTATGCCGAAGCTTATGCCGACGGAGGCAAGCGTGTCCACGACAGAAGCTTCCC
CGTCATGTACCTCTACACCAACGAGTTGTGAGTCTTTCCCTCACCATGGCCTACACTTGGTGGGAGCTGACTCGA
CTTTTTTTTTTTTTTTTTTTTGAACAGTGGATGGGCTCAAAACTCGACTCTCTCGAAACTCACGGCTGAAAAGGC
CAAGGACACCATCACGGAAAAGATGCGCAAGGACCTCAGGGCCGCGTACGAGCTCGCCGCCGAACACAACGACGT
CGATCACTACAAGGAGATACTCCAGTCCTTCCAGGAGGAGCAGATTGCACAGGAAGAGGCCAGAAAGCAGACCGT
CACCCTCAAAAGGGCCAAGAAGGGCAAGGGTAAGGCTCTCGACGACGATGACGACCTCGACATCGAAATGGATGA
TGCCAACGTCATTCCCAAGTCGGCCAAATCTAAGAAGCGGAAGGCCGAGGACGACACCAGCGTAAGTTGATTTCC
CATCATGGAGGGGGCTTATTTTTTTTTTTTGTTTGGGGGGGGGGGGGGGGTGGGAAGGGGCTGACGTTGCGGACC
GTCCTAGACTCCTCAGAGACCCGACTCGGTCAAGAAGCCCAAGATCAAGCTCAACACGTCGTCGACTCCCAAGAC
GGCCAACGGCGCCGCCACGCCCAAGTCGGCCGGTGCTTCTGCCGCCAAGGGCTCCAAGTCGAAGCCTAAGAAGGC
CAAAGACGGGGGCGACAAGAAGGCGGAGACGCCCAAGGAGGCTAAGATGACTCCCGAGGAGCGCAGGGCTCGGAA
AGAGGTACGTGGCCCCGGATCGCAAATCATTCATCGGGTCTGACGACGACGGACGCGCGCAGAAAGAGGTTCTCT
ACCTCCGTCACAAGCTCCAGCGGGGCCTCCTTACCAGGGAGCAGCAGCCGCGGGAGGACGAGATGAAGACCATGT
CGGACTTCGTCACGGTCCTCGAGAACATGGTCGACCTCGAGGTCTCCATCATCAGGGCGACCAAGATCAACAAGG
TGCTCAAGGCCATCCTCAAGCTCGACTCGATCCCCCGCGAGGAGGACTTTGAGTTCAAAAAGAGATCGCAGTCGC
TGCTCGACAAGTGGAACAAGCTGCTCGCCGACGATGGCTCCGGTGCCACGACGGCTCCGACCAACGGCGTCAACG
GGGCGGCCGAGGAGAAGAAGGGCAAGGCCGCCAATGGCGTCAAGGACGACGCCCGCGAGGCCCCCAAGGCCGACT
CGGACAAGGACGAACCCGACAAGACTGAGGAGAAGGGCGGCGAGGAAGACTCGGTCGCCAAGGACTCGGCCGCCG
AGGACAAGGCGGAAGGTGCTGTCGAAGACAAGGCCGAGGCTGCCGAGGAGAAGACGGAGACGGCCGAGGAGAAGA
CGGAGACGGCCGAGAAGAAGACGGAGCCGGCCGAGGACAAGGCAGAGGAGGCCGTCGAGGAGGCCGTCGAGGAGA
CCGACAAGAAGGCCGTCAAGGAAGCGACTCCCGCAGCGGTACGTTGTTACTCGGCGTGTCTCGTGATGTGAGCTG
ACATTCTTCTCTATGCGCAGGACGTTGCGTCGGATGCGGAAAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail