Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04551
Gene name
Locationscaffold_04:3549885..3551509
Strand-
Gene length (bp)1624
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10329 DUF2417 Region of unknown function (DUF2417) 4.9E-81 35 259

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 65 87 22
2 102 124 22
3 131 153 22
4 158 177 19
5 206 228 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 373.58 175.59 571.56
Alive In ants, during behavior modification 42.33 18.75 65.91
Dead In ants, recently dead 59.78 33.82 85.75

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.061742 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04551
MPLFSKANNDSDGDNEGRSSSQQPAHHDRQPPADERTRLLPGRGDGMLAPDDPAVSPYNLWSIRILRYLTLFVTA
ITFAWWLVLLVSVFATPPGLNTRGSSFLAYGFTSLALANMLFTLVFFGVPSKSVRILAIVTAVMLFLDLVLLASV
QQTRYEEGWVGLVSATWALLMSIWALLADRAVKWGKEEEEERLTGRAETRRTLSEWLAVLLSTIAYVVMAVAVLL
MTLTIILRSLDAGLAAPGKLYEVDGGKYRIHIYCHGNATDQPTVLLEGGERPVEQGLWKLADKAMRNRSFSRYCF
VDRPGYGWSDTAPSPLSAGFAVDVLSEALASADERGPWVLASAGIGSLYSRVFSSRHAHEVRGIVLIDPLHEDLL
DEVASSGRGFLLWLRGVISPLGLDRLSGAIFRGRTSRDRIYGRSSSQGSKLIFTRLQENLVANSFTRRDVQGSRR
IQHKKTALVVISSGIEMKRSEDWAQKQRDLTKLTDNLKHWDVVDDAPHEVWESSEGSERIEERLRQMVHA*
Coding >Ophcf2|04551
ATGCCGCTCTTCTCAAAGGCAAACAACGACTCGGACGGCGATAATGAGGGACGCTCGTCCTCGCAACAGCCTGCT
CATCATGACAGACAGCCGCCGGCTGATGAGCGGACTCGGCTTTTGCCCGGCCGTGGAGATGGCATGCTCGCTCCT
GACGATCCTGCTGTCTCGCCCTATAACCTCTGGAGTATCCGCATCTTGAGATACCTGACGCTATTTGTCACGGCC
ATTACCTTTGCCTGGTGGCTGGTGCTGCTCGTGTCCGTCTTTGCCACGCCGCCGGGTCTCAATACGCGCGGCAGC
AGCTTCTTGGCATATGGCTTCACCAGTCTGGCCCTGGCCAACATGCTCTTTACCCTCGTCTTCTTCGGCGTGCCG
TCCAAGTCGGTCCGCATCCTGGCTATAGTCACGGCTGTGATGCTGTTCCTGGATCTTGTCCTGCTCGCCAGTGTA
CAGCAGACGCGCTATGAAGAGGGCTGGGTCGGTCTCGTCAGCGCCACCTGGGCCCTACTCATGAGCATATGGGCT
CTGCTCGCCGATCGAGCCGTCAAATGGGGCAAGGAAGAGGAGGAAGAGCGGCTGACAGGTCGGGCCGAGACGCGT
CGTACCCTGTCCGAGTGGCTGGCGGTGCTACTGTCGACCATTGCCTACGTCGTCATGGCTGTTGCCGTCCTTCTC
ATGACGCTGACTATCATCCTGCGCTCTCTCGACGCCGGCTTGGCGGCCCCCGGCAAGCTGTACGAGGTGGACGGC
GGTAAATATCGGATTCACATCTACTGCCACGGTAACGCTACCGATCAGCCGACTGTGCTCCTGGAGGGAGGCGAG
AGGCCTGTCGAGCAGGGTCTGTGGAAGCTGGCCGACAAGGCGATGCGCAACCGATCCTTCTCGCGCTACTGCTTC
GTCGACCGTCCGGGCTACGGCTGGTCAGACACGGCGCCATCGCCGCTGTCGGCCGGGTTTGCCGTAGACGTGCTC
AGCGAGGCACTGGCGTCGGCCGACGAAAGGGGACCATGGGTGCTGGCCAGCGCGGGCATCGGCTCCCTATACTCG
CGCGTCTTTTCGTCCCGACACGCGCACGAGGTCCGAGGGATCGTCCTGATCGATCCCCTGCACGAGGACCTCCTC
GACGAGGTAGCCTCTTCGGGACGCGGATTCCTACTCTGGCTGCGTGGCGTCATCTCGCCTCTGGGACTAGACAGG
TTATCAGGCGCCATCTTCCGAGGCCGCACGAGCCGAGATCGCATCTACGGCCGATCCTCGTCACAGGGCAGCAAG
CTCATCTTCACACGACTGCAGGAGAACCTAGTTGCCAACTCGTTCACGCGTCGCGACGTGCAAGGCAGCCGACGG
ATCCAACATAAGAAGACGGCTCTCGTCGTCATCAGCTCCGGCATCGAGATGAAGCGCAGCGAGGACTGGGCGCAG
AAGCAGCGGGATCTGACCAAGTTGACGGATAACCTGAAGCATTGGGATGTGGTTGACGATGCGCCTCATGAGGTG
TGGGAGTCTTCTGAAGGCAGCGAGCGGATTGAGGAGCGATTGCGACAGATGGTTCATGCTTGA
Transcript >Ophcf2|04551
ATGCCGCTCTTCTCAAAGGCAAACAACGACTCGGACGGCGATAATGAGGGACGCTCGTCCTCGCAACAGCCTGCT
CATCATGACAGACAGCCGCCGGCTGATGAGCGGACTCGGCTTTTGCCCGGCCGTGGAGATGGCATGCTCGCTCCT
GACGATCCTGCTGTCTCGCCCTATAACCTCTGGAGTATCCGCATCTTGAGATACCTGACGCTATTTGTCACGGCC
ATTACCTTTGCCTGGTGGCTGGTGCTGCTCGTGTCCGTCTTTGCCACGCCGCCGGGTCTCAATACGCGCGGCAGC
AGCTTCTTGGCATATGGCTTCACCAGTCTGGCCCTGGCCAACATGCTCTTTACCCTCGTCTTCTTCGGCGTGCCG
TCCAAGTCGGTCCGCATCCTGGCTATAGTCACGGCTGTGATGCTGTTCCTGGATCTTGTCCTGCTCGCCAGTGTA
CAGCAGACGCGCTATGAAGAGGGCTGGGTCGGTCTCGTCAGCGCCACCTGGGCCCTACTCATGAGCATATGGGCT
CTGCTCGCCGATCGAGCCGTCAAATGGGGCAAGGAAGAGGAGGAAGAGCGGCTGACAGGTCGGGCCGAGACGCGT
CGTACCCTGTCCGAGTGGCTGGCGGTGCTACTGTCGACCATTGCCTACGTCGTCATGGCTGTTGCCGTCCTTCTC
ATGACGCTGACTATCATCCTGCGCTCTCTCGACGCCGGCTTGGCGGCCCCCGGCAAGCTGTACGAGGTGGACGGC
GGTAAATATCGGATTCACATCTACTGCCACGGTAACGCTACCGATCAGCCGACTGTGCTCCTGGAGGGAGGCGAG
AGGCCTGTCGAGCAGGGTCTGTGGAAGCTGGCCGACAAGGCGATGCGCAACCGATCCTTCTCGCGCTACTGCTTC
GTCGACCGTCCGGGCTACGGCTGGTCAGACACGGCGCCATCGCCGCTGTCGGCCGGGTTTGCCGTAGACGTGCTC
AGCGAGGCACTGGCGTCGGCCGACGAAAGGGGACCATGGGTGCTGGCCAGCGCGGGCATCGGCTCCCTATACTCG
CGCGTCTTTTCGTCCCGACACGCGCACGAGGTCCGAGGGATCGTCCTGATCGATCCCCTGCACGAGGACCTCCTC
GACGAGGTAGCCTCTTCGGGACGCGGATTCCTACTCTGGCTGCGTGGCGTCATCTCGCCTCTGGGACTAGACAGG
TTATCAGGCGCCATCTTCCGAGGCCGCACGAGCCGAGATCGCATCTACGGCCGATCCTCGTCACAGGGCAGCAAG
CTCATCTTCACACGACTGCAGGAGAACCTAGTTGCCAACTCGTTCACGCGTCGCGACGTGCAAGGCAGCCGACGG
ATCCAACATAAGAAGACGGCTCTCGTCGTCATCAGCTCCGGCATCGAGATGAAGCGCAGCGAGGACTGGGCGCAG
AAGCAGCGGGATCTGACCAAGTTGACGGATAACCTGAAGCATTGGGATGTGGTTGACGATGCGCCTCATGAGGTG
TGGGAGTCTTCTGAAGGCAGCGAGCGGATTGAGGAGCGATTGCGACAGATGGTTCATGCTTGA
Gene >Ophcf2|04551
ATGCCGCTCTTCTCAAAGGCAAACAACGACTCGGACGGCGATAATGAGGGACGCTCGTCCTCGCAACAGCCTGCT
CATCATGACAGACAGCCGCCGGCTGATGAGCGGACTCGGCTTTTGCCCGGCCGTGGAGATGGCATGCTCGCTCCT
GACGATCCTGCTGTCTCGCCCTATAACCTCTGGAGTATCCGCATCTTGAGATACCTGACGCTATTTGTCACGGCC
ATTACCTTTGCCTGGTGGCTGGTGCTGCTCGTGTCCGTCTTTGCCACGCCGCCGGGTCTCAATACGCGCGGCAGC
AGCTTCTTGGCATATGGCTTCACCAGTCTGGCCCTGGCCAACATGCTCTTTACCCTCGTCTTCTTCGGCGTGCCG
TCCAAGTCGGTCCGCATCCTGGCTATAGTCACGGCTGTATGTCGCTCCTCCATACTCTTCTTCTCTTGCGAATCC
TTCTAACAGACCATGGCCACAGGTGATGCTGTTCCTGGATCTTGTCCTGCTCGCCAGTGTACAGCAGACGCGCTA
TGAAGAGGGCTGGGTCGGTCTCGTCAGCGCCACCTGGGCCCTACTCATGAGCATATGGGCTCTGCTCGCCGATCG
AGCCGTCAAATGGGGCAAGGAAGAGGAGGAAGAGCGGCTGACAGGTCGGGCCGAGACGCGTCGTACCCTGTCCGA
GTGGCTGGCGGTGCTACTGTCGACCATTGCCTACGTCGTCATGGCTGTTGCCGTCCTTCTCATGACGCTGACTAT
CATCCTGCGCTCTCTCGACGCCGGCTTGGCGGCCCCCGGCAAGCTGTACGAGGTGGACGGCGGTAAATATCGGAT
TCACATCTACTGCCACGGTAACGCTACCGATCAGCCGACTGTGCTCCTGGAGGGAGGCGAGAGGCCTGTCGAGCA
GGGTCTGTGGAAGCTGGCCGACAAGGCGATGCGCAACCGATCCTTCTCGCGCTACTGCTTCGTCGACCGTCCGGG
CTACGGCTGGTCAGACACGGCGCCATCGCCGCTGTCGGCCGGGTTTGCCGTAGACGTGCTCAGCGAGGCACTGGC
GTCGGCCGACGAAAGGGGACCATGGGTGCTGGCCAGCGCGGGCATCGGCTCCCTATACTCGCGCGTCTTTTCGTC
CCGACACGCGCACGAGGTCCGAGGGATCGTCCTGATCGATCCCCTGCACGAGGACCTCCTCGACGAGGTAGCCTC
TTCGGGACGCGGATTCCTACTCTGGCTGCGTGGCGTCATCTCGCCTCTGGGACTAGACAGGTTATCAGGCGCCAT
CTTCCGAGGCCGCACGAGCCGAGATCGCATCTACGGCCGATCCTCGTCACAGGGCAGCAAGCTCATCTTCACACG
ACTGCAGGAGAACCTAGTTGCCAACTCGTTCACGCGTCGCGACGTGCAAGGCAGCCGACGGATCCAACATAAGAA
GACGGCTCTCGTCGTCATCAGCTCCGGCATCGAGATGAAGCGCAGCGAGGACTGGGCGCAGAAGCAGCGGGATCT
GACCAAGTTGACGGATAACCTGAAGCATTGGGATGTGGTTGACGATGCGCCTCATGAGGTGTGGGAGTCTTCTGA
AGGCAGCGAGCGGATTGAGGAGCGATTGCGACAGATGGTTCATGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail