Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04551
Gene name
Locationscaffold_04:3549885..3551509
Strand-
Gene length (bp)1624
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10329 DUF2417 Region of unknown function (DUF2417) 4.9E-81 35 259

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 65 87 22
2 102 124 22
3 131 153 22
4 158 177 19
5 206 228 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04551
MPLFSKANNDSDGDNEGRSSSQQPAHHDRQPPADERTRLLPGRGDGMLAPDDPAVSPYNLWSIRILRYLTLFVTA
ITFAWWLVLLVSVFATPPGLNTRGSSFLAYGFTSLALANMLFTLVFFGVPSKSVRILAIVTAVMLFLDLVLLASV
QQTRYEEGWVGLVSATWALLMSIWALLADRAVKWGKEEEEERLTGRAETRRTLSEWLAVLLSTIAYVVMAVAVLL
MTLTIILRSLDAGLAAPGKLYEVDGGKYRIHIYCHGNATDQPTVLLEGGERPVEQGLWKLADKAMRNRSFSRYCF
VDRPGYGWSDTAPSPLSAGFAVDVLSEALASADERGPWVLASAGIGSLYSRVFSSRHAHEVRGIVLIDPLHEDLL
DEVASSGRGFLLWLRGVISPLGLDRLSGAIFRGRTSRDRIYGRSSSQGSKLIFTRLQENLVANSFTRRDVQGSRR
IQHKKTALVVISSGIEMKRSEDWAQKQRDLTKLTDNLKHWDVVDDAPHEVWESSEGSERIEERLRQMVHA*
Coding >Ophcf2|04551
ATGCCGCTCTTCTCAAAGGCAAACAACGACTCGGACGGCGATAATGAGGGACGCTCGTCCTCGCAACAGCCTGCT
CATCATGACAGACAGCCGCCGGCTGATGAGCGGACTCGGCTTTTGCCCGGCCGTGGAGATGGCATGCTCGCTCCT
GACGATCCTGCTGTCTCGCCCTATAACCTCTGGAGTATCCGCATCTTGAGATACCTGACGCTATTTGTCACGGCC
ATTACCTTTGCCTGGTGGCTGGTGCTGCTCGTGTCCGTCTTTGCCACGCCGCCGGGTCTCAATACGCGCGGCAGC
AGCTTCTTGGCATATGGCTTCACCAGTCTGGCCCTGGCCAACATGCTCTTTACCCTCGTCTTCTTCGGCGTGCCG
TCCAAGTCGGTCCGCATCCTGGCTATAGTCACGGCTGTGATGCTGTTCCTGGATCTTGTCCTGCTCGCCAGTGTA
CAGCAGACGCGCTATGAAGAGGGCTGGGTCGGTCTCGTCAGCGCCACCTGGGCCCTACTCATGAGCATATGGGCT
CTGCTCGCCGATCGAGCCGTCAAATGGGGCAAGGAAGAGGAGGAAGAGCGGCTGACAGGTCGGGCCGAGACGCGT
CGTACCCTGTCCGAGTGGCTGGCGGTGCTACTGTCGACCATTGCCTACGTCGTCATGGCTGTTGCCGTCCTTCTC
ATGACGCTGACTATCATCCTGCGCTCTCTCGACGCCGGCTTGGCGGCCCCCGGCAAGCTGTACGAGGTGGACGGC
GGTAAATATCGGATTCACATCTACTGCCACGGTAACGCTACCGATCAGCCGACTGTGCTCCTGGAGGGAGGCGAG
AGGCCTGTCGAGCAGGGTCTGTGGAAGCTGGCCGACAAGGCGATGCGCAACCGATCCTTCTCGCGCTACTGCTTC
GTCGACCGTCCGGGCTACGGCTGGTCAGACACGGCGCCATCGCCGCTGTCGGCCGGGTTTGCCGTAGACGTGCTC
AGCGAGGCACTGGCGTCGGCCGACGAAAGGGGACCATGGGTGCTGGCCAGCGCGGGCATCGGCTCCCTATACTCG
CGCGTCTTTTCGTCCCGACACGCGCACGAGGTCCGAGGGATCGTCCTGATCGATCCCCTGCACGAGGACCTCCTC
GACGAGGTAGCCTCTTCGGGACGCGGATTCCTACTCTGGCTGCGTGGCGTCATCTCGCCTCTGGGACTAGACAGG
TTATCAGGCGCCATCTTCCGAGGCCGCACGAGCCGAGATCGCATCTACGGCCGATCCTCGTCACAGGGCAGCAAG
CTCATCTTCACACGACTGCAGGAGAACCTAGTTGCCAACTCGTTCACGCGTCGCGACGTGCAAGGCAGCCGACGG
ATCCAACATAAGAAGACGGCTCTCGTCGTCATCAGCTCCGGCATCGAGATGAAGCGCAGCGAGGACTGGGCGCAG
AAGCAGCGGGATCTGACCAAGTTGACGGATAACCTGAAGCATTGGGATGTGGTTGACGATGCGCCTCATGAGGTG
TGGGAGTCTTCTGAAGGCAGCGAGCGGATTGAGGAGCGATTGCGACAGATGGTTCATGCTTGA
Transcript >Ophcf2|04551
ATGCCGCTCTTCTCAAAGGCAAACAACGACTCGGACGGCGATAATGAGGGACGCTCGTCCTCGCAACAGCCTGCT
CATCATGACAGACAGCCGCCGGCTGATGAGCGGACTCGGCTTTTGCCCGGCCGTGGAGATGGCATGCTCGCTCCT
GACGATCCTGCTGTCTCGCCCTATAACCTCTGGAGTATCCGCATCTTGAGATACCTGACGCTATTTGTCACGGCC
ATTACCTTTGCCTGGTGGCTGGTGCTGCTCGTGTCCGTCTTTGCCACGCCGCCGGGTCTCAATACGCGCGGCAGC
AGCTTCTTGGCATATGGCTTCACCAGTCTGGCCCTGGCCAACATGCTCTTTACCCTCGTCTTCTTCGGCGTGCCG
TCCAAGTCGGTCCGCATCCTGGCTATAGTCACGGCTGTGATGCTGTTCCTGGATCTTGTCCTGCTCGCCAGTGTA
CAGCAGACGCGCTATGAAGAGGGCTGGGTCGGTCTCGTCAGCGCCACCTGGGCCCTACTCATGAGCATATGGGCT
CTGCTCGCCGATCGAGCCGTCAAATGGGGCAAGGAAGAGGAGGAAGAGCGGCTGACAGGTCGGGCCGAGACGCGT
CGTACCCTGTCCGAGTGGCTGGCGGTGCTACTGTCGACCATTGCCTACGTCGTCATGGCTGTTGCCGTCCTTCTC
ATGACGCTGACTATCATCCTGCGCTCTCTCGACGCCGGCTTGGCGGCCCCCGGCAAGCTGTACGAGGTGGACGGC
GGTAAATATCGGATTCACATCTACTGCCACGGTAACGCTACCGATCAGCCGACTGTGCTCCTGGAGGGAGGCGAG
AGGCCTGTCGAGCAGGGTCTGTGGAAGCTGGCCGACAAGGCGATGCGCAACCGATCCTTCTCGCGCTACTGCTTC
GTCGACCGTCCGGGCTACGGCTGGTCAGACACGGCGCCATCGCCGCTGTCGGCCGGGTTTGCCGTAGACGTGCTC
AGCGAGGCACTGGCGTCGGCCGACGAAAGGGGACCATGGGTGCTGGCCAGCGCGGGCATCGGCTCCCTATACTCG
CGCGTCTTTTCGTCCCGACACGCGCACGAGGTCCGAGGGATCGTCCTGATCGATCCCCTGCACGAGGACCTCCTC
GACGAGGTAGCCTCTTCGGGACGCGGATTCCTACTCTGGCTGCGTGGCGTCATCTCGCCTCTGGGACTAGACAGG
TTATCAGGCGCCATCTTCCGAGGCCGCACGAGCCGAGATCGCATCTACGGCCGATCCTCGTCACAGGGCAGCAAG
CTCATCTTCACACGACTGCAGGAGAACCTAGTTGCCAACTCGTTCACGCGTCGCGACGTGCAAGGCAGCCGACGG
ATCCAACATAAGAAGACGGCTCTCGTCGTCATCAGCTCCGGCATCGAGATGAAGCGCAGCGAGGACTGGGCGCAG
AAGCAGCGGGATCTGACCAAGTTGACGGATAACCTGAAGCATTGGGATGTGGTTGACGATGCGCCTCATGAGGTG
TGGGAGTCTTCTGAAGGCAGCGAGCGGATTGAGGAGCGATTGCGACAGATGGTTCATGCTTGA
Gene >Ophcf2|04551
ATGCCGCTCTTCTCAAAGGCAAACAACGACTCGGACGGCGATAATGAGGGACGCTCGTCCTCGCAACAGCCTGCT
CATCATGACAGACAGCCGCCGGCTGATGAGCGGACTCGGCTTTTGCCCGGCCGTGGAGATGGCATGCTCGCTCCT
GACGATCCTGCTGTCTCGCCCTATAACCTCTGGAGTATCCGCATCTTGAGATACCTGACGCTATTTGTCACGGCC
ATTACCTTTGCCTGGTGGCTGGTGCTGCTCGTGTCCGTCTTTGCCACGCCGCCGGGTCTCAATACGCGCGGCAGC
AGCTTCTTGGCATATGGCTTCACCAGTCTGGCCCTGGCCAACATGCTCTTTACCCTCGTCTTCTTCGGCGTGCCG
TCCAAGTCGGTCCGCATCCTGGCTATAGTCACGGCTGTATGTCGCTCCTCCATACTCTTCTTCTCTTGCGAATCC
TTCTAACAGACCATGGCCACAGGTGATGCTGTTCCTGGATCTTGTCCTGCTCGCCAGTGTACAGCAGACGCGCTA
TGAAGAGGGCTGGGTCGGTCTCGTCAGCGCCACCTGGGCCCTACTCATGAGCATATGGGCTCTGCTCGCCGATCG
AGCCGTCAAATGGGGCAAGGAAGAGGAGGAAGAGCGGCTGACAGGTCGGGCCGAGACGCGTCGTACCCTGTCCGA
GTGGCTGGCGGTGCTACTGTCGACCATTGCCTACGTCGTCATGGCTGTTGCCGTCCTTCTCATGACGCTGACTAT
CATCCTGCGCTCTCTCGACGCCGGCTTGGCGGCCCCCGGCAAGCTGTACGAGGTGGACGGCGGTAAATATCGGAT
TCACATCTACTGCCACGGTAACGCTACCGATCAGCCGACTGTGCTCCTGGAGGGAGGCGAGAGGCCTGTCGAGCA
GGGTCTGTGGAAGCTGGCCGACAAGGCGATGCGCAACCGATCCTTCTCGCGCTACTGCTTCGTCGACCGTCCGGG
CTACGGCTGGTCAGACACGGCGCCATCGCCGCTGTCGGCCGGGTTTGCCGTAGACGTGCTCAGCGAGGCACTGGC
GTCGGCCGACGAAAGGGGACCATGGGTGCTGGCCAGCGCGGGCATCGGCTCCCTATACTCGCGCGTCTTTTCGTC
CCGACACGCGCACGAGGTCCGAGGGATCGTCCTGATCGATCCCCTGCACGAGGACCTCCTCGACGAGGTAGCCTC
TTCGGGACGCGGATTCCTACTCTGGCTGCGTGGCGTCATCTCGCCTCTGGGACTAGACAGGTTATCAGGCGCCAT
CTTCCGAGGCCGCACGAGCCGAGATCGCATCTACGGCCGATCCTCGTCACAGGGCAGCAAGCTCATCTTCACACG
ACTGCAGGAGAACCTAGTTGCCAACTCGTTCACGCGTCGCGACGTGCAAGGCAGCCGACGGATCCAACATAAGAA
GACGGCTCTCGTCGTCATCAGCTCCGGCATCGAGATGAAGCGCAGCGAGGACTGGGCGCAGAAGCAGCGGGATCT
GACCAAGTTGACGGATAACCTGAAGCATTGGGATGTGGTTGACGATGCGCCTCATGAGGTGTGGGAGTCTTCTGA
AGGCAGCGAGCGGATTGAGGAGCGATTGCGACAGATGGTTCATGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail