Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04545
Gene name
Locationscaffold_04:3538031..3538650
Strand-
Gene length (bp)619
Transcript length (bp)519
Coding sequence length (bp)519
Protein length (aa) 173

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00717 Peptidase_S24 Peptidase S24-like 4.9E-06 28 136

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Transmembrane domain 0.1495 0.1561 0.033 0.1271 0.4307 0.0599 0.7759 0.1828 0.1473 0.0069

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 131 150 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4305
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7872
Ophiocordyceps australis map64 (Brazil) OphauB2|3481
Ophiocordyceps camponoti-floridani Ophcf2|04545 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6925
Ophiocordyceps kimflemingae Ophio5|7153
Ophiocordyceps subramaniannii Hirsu2|8816

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04545
MLPGLQNPRQAAAQLMNFALILSTAFMMWKGLSVITDSPSPIVVVLSGSMEPAFQRGDLLLLWNRNLMRETEVGE
VVVYNVKDKDIPIVHRLVRKFGSGDKAKLLTKGDNNVADDTDLYARGQDYLERKDIIGSVVGYVPFVGYVTIMLS
EHPWMKTAMLGLMGVLVVLQRE*
Coding >Ophcf2|04545
ATGCTTCCAGGGCTTCAAAATCCTCGTCAAGCTGCGGCGCAGCTGATGAACTTTGCCCTTATCCTCTCGACGGCT
TTCATGATGTGGAAGGGCCTATCCGTCATTACCGACTCGCCATCGCCAATCGTCGTCGTTCTATCCGGCTCAATG
GAGCCAGCTTTCCAGCGTGGCGACCTTTTGCTGCTGTGGAATCGGAATCTCATGAGGGAGACCGAGGTCGGCGAG
GTAGTCGTCTACAACGTCAAGGACAAGGATATCCCCATTGTTCACAGGCTTGTGCGCAAATTTGGTTCCGGCGAC
AAGGCCAAGCTTCTCACAAAGGGCGACAACAACGTCGCCGACGACACCGATTTATACGCCCGCGGGCAGGACTAT
CTGGAGCGCAAGGACATTATCGGTAGTGTTGTCGGCTACGTACCCTTTGTTGGCTACGTCACCATCATGTTGTCA
GAACACCCGTGGATGAAGACGGCGATGCTAGGACTGATGGGCGTGCTAGTCGTTCTACAGCGAGAGTGA
Transcript >Ophcf2|04545
ATGCTTCCAGGGCTTCAAAATCCTCGTCAAGCTGCGGCGCAGCTGATGAACTTTGCCCTTATCCTCTCGACGGCT
TTCATGATGTGGAAGGGCCTATCCGTCATTACCGACTCGCCATCGCCAATCGTCGTCGTTCTATCCGGCTCAATG
GAGCCAGCTTTCCAGCGTGGCGACCTTTTGCTGCTGTGGAATCGGAATCTCATGAGGGAGACCGAGGTCGGCGAG
GTAGTCGTCTACAACGTCAAGGACAAGGATATCCCCATTGTTCACAGGCTTGTGCGCAAATTTGGTTCCGGCGAC
AAGGCCAAGCTTCTCACAAAGGGCGACAACAACGTCGCCGACGACACCGATTTATACGCCCGCGGGCAGGACTAT
CTGGAGCGCAAGGACATTATCGGTAGTGTTGTCGGCTACGTACCCTTTGTTGGCTACGTCACCATCATGTTGTCA
GAACACCCGTGGATGAAGACGGCGATGCTAGGACTGATGGGCGTGCTAGTCGTTCTACAGCGAGAGTGA
Gene >Ophcf2|04545
ATGCTTCCAGGGCTTCAAAATCCTCGTCAAGCTGCGGCGCAGCTGATGAACTTTGCCCTTATCCTCTCGACGGCT
TTCATGGTACGTCAGGCCATGGCGCGACCCATACTCGCTCTCATACTTTGCAGATGTGGAAGGGCCTATCCGTCA
TTACCGACTCGCCATCGCCAATCGTCGTCGTTCTATCCGGCTCAATGGAGCCAGCTTTCCAGCGTGGCGACCTTT
TGCTGCTGTGGAATCGGAATCTCATGAGGGAGACCGAGGTCGGCGAGGTAGTCGTCTACAACGTCAAGGACAAGG
ATATCCCCATTGTTCACAGGCTTGTGCGCAAATTTGGTTCCGGGTACGTTGTCCTCGCCAAATCCAGCGGTCGGG
TGAAGCTCATTGGTACGGTAGCGACAAGGCCAAGCTTCTCACAAAGGGCGACAACAACGTCGCCGACGACACCGA
TTTATACGCCCGCGGGCAGGACTATCTGGAGCGCAAGGACATTATCGGTAGTGTTGTCGGCTACGTACCCTTTGT
TGGCTACGTCACCATCATGTTGTCAGAACACCCGTGGATGAAGACGGCGATGCTAGGACTGATGGGCGTGCTAGT
CGTTCTACAGCGAGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail