Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04541
Gene name
Locationscaffold_04:3524725..3527694
Strand-
Gene length (bp)2969
Transcript length (bp)1719
Coding sequence length (bp)1719
Protein length (aa) 573

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.3E-30 49 401

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 79 101 22
3 116 138 22
4 145 164 19
5 179 201 22
6 214 236 22
7 256 278 22
8 291 313 22
9 323 345 22
10 352 374 22
11 384 406 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 234.82 115.46 354.18
Alive In ants, during behavior modification 25.61 13.20 38.02
Dead In ants, recently dead 12.18 5.55 18.82

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04541
MLQDGGSDTTSTKMMSDSNASELGTEGRRAWASQGMKPWREALLVFTACMAQFCTQTAFFSTLILLRPIGASFGI
DSPARLAWLVAAFSLAAGTLIIFCGRLGDVFGHGRMLILGFTWWALWSAISGLSVYSTFYLSVISRAMQGVGPAV
TLPNALAVLGTAYPPGHRKAMVFAMFGAVAPVGAVVGGVFSTAVIGIVALVLFSFAWTQAPVDGWSAPSVLVPLV
AGLALFGLFLYTETKLSPAPLVPLQALTADVGFVLAAVLFGWASFGVWTLYLVQTLQEARGLSPLMLTAYFCPVA
LSGATAAVATGLMLGPLRLGPPTVMTVALAAFTIGSILTAVAPVHQTYWAQLFVAFLVMPVGMDCSFPASTLVVS
NAVARRHQGVGASLVSTVVNYGIALGVGFAGTAEMYVRGDPDTVEGRLRGRRIPPFVESVERVSPDVTFLAAHAY
ALKQAIDETIFLVKETDKLNMRETQEILVALESVKIEGHRGTEALGKPRDRIKELKLCGFMRTQIYQLQYKFRWL
IPHLLDKFPKAAKGVGGTVRITLERFLEDWAKAYTLYNCKNDLYDTA*
Coding >Ophcf2|04541
ATGCTGCAAGATGGCGGCTCGGATACTACGTCGACCAAGATGATGTCGGATTCCAACGCGTCGGAACTCGGCACG
GAGGGGAGGAGGGCTTGGGCTTCGCAGGGGATGAAGCCTTGGAGGGAGGCTTTGTTGGTCTTTACTGCTTGCATG
GCGCAGTTTTGCACTCAGACGGCCTTCTTTTCTACCCTCATCCTCTTGCGTCCTATCGGCGCCTCGTTCGGTATC
GACAGTCCGGCGAGATTGGCCTGGCTCGTGGCCGCCTTCTCCCTCGCAGCCGGTACCCTCATCATCTTCTGCGGA
CGTCTGGGCGATGTCTTTGGCCACGGCCGGATGCTCATCTTGGGCTTCACCTGGTGGGCTCTCTGGTCCGCCATC
TCGGGCCTATCCGTCTACTCGACCTTTTACCTCTCCGTCATCTCCCGCGCCATGCAAGGCGTAGGCCCGGCCGTG
ACGCTCCCCAACGCACTGGCGGTACTGGGAACAGCCTATCCGCCGGGCCATCGCAAGGCCATGGTCTTCGCCATG
TTCGGGGCTGTGGCCCCGGTCGGGGCCGTCGTCGGGGGCGTCTTTTCGACCGCAGTCATCGGAATCGTCGCTCTC
GTTCTCTTTAGCTTCGCCTGGACGCAAGCGCCCGTCGACGGCTGGTCCGCGCCATCCGTCCTGGTCCCTCTCGTG
GCAGGCCTCGCCCTCTTCGGCCTCTTCCTCTACACGGAGACGAAGCTGAGCCCGGCACCGCTGGTCCCCCTCCAG
GCTCTAACGGCAGACGTGGGCTTCGTGCTGGCCGCCGTGCTGTTCGGCTGGGCGAGTTTCGGCGTGTGGACGCTG
TATCTCGTGCAGACGCTGCAGGAGGCGCGCGGGTTGTCGCCCCTGATGCTGACGGCTTACTTTTGCCCCGTTGCT
CTATCGGGTGCGACGGCGGCGGTTGCCACGGGCTTGATGCTGGGGCCTCTACGGCTCGGGCCGCCTACTGTCATG
ACGGTCGCCTTGGCTGCCTTTACGATCGGTTCCATACTGACGGCCGTGGCTCCCGTTCATCAGACGTACTGGGCG
CAGCTGTTCGTCGCCTTTCTCGTCATGCCCGTCGGTATGGACTGTTCCTTTCCAGCCTCGACGCTCGTCGTGTCC
AACGCGGTGGCGAGGAGACACCAGGGGGTCGGGGCGAGTCTCGTGAGCACCGTCGTCAACTACGGCATCGCCCTG
GGGGTCGGATTCGCCGGCACGGCGGAGATGTACGTCCGTGGCGATCCGGACACCGTCGAGGGGAGGCTTCGGGGC
AGAAGGATACCGCCCTTTGTGGAATCCGTCGAGCGGGTCAGCCCAGACGTCACCTTCCTGGCGGCCCACGCCTAC
GCCCTCAAACAGGCCATCGACGAGACCATCTTCCTGGTCAAGGAAACGGACAAGCTCAACATGAGGGAGACGCAG
GAGATCCTCGTCGCCCTGGAGAGCGTCAAGATTGAGGGTCATAGGGGCACCGAGGCGCTGGGGAAGCCGAGGGAT
CGGATCAAGGAGTTGAAGTTGTGTGGGTTTATGAGGACGCAGATCTATCAGCTTCAGTACAAGTTTCGCTGGTTG
ATTCCACATCTGCTCGATAAGTTTCCCAAGGCGGCCAAGGGGGTGGGTGGCACTGTGAGGATTACCCTGGAAAGG
TTTCTTGAGGATTGGGCAAAGGCGTATACCTTGTACAATTGCAAGAATGACCTGTATGACACTGCCTAG
Transcript >Ophcf2|04541
ATGCTGCAAGATGGCGGCTCGGATACTACGTCGACCAAGATGATGTCGGATTCCAACGCGTCGGAACTCGGCACG
GAGGGGAGGAGGGCTTGGGCTTCGCAGGGGATGAAGCCTTGGAGGGAGGCTTTGTTGGTCTTTACTGCTTGCATG
GCGCAGTTTTGCACTCAGACGGCCTTCTTTTCTACCCTCATCCTCTTGCGTCCTATCGGCGCCTCGTTCGGTATC
GACAGTCCGGCGAGATTGGCCTGGCTCGTGGCCGCCTTCTCCCTCGCAGCCGGTACCCTCATCATCTTCTGCGGA
CGTCTGGGCGATGTCTTTGGCCACGGCCGGATGCTCATCTTGGGCTTCACCTGGTGGGCTCTCTGGTCCGCCATC
TCGGGCCTATCCGTCTACTCGACCTTTTACCTCTCCGTCATCTCCCGCGCCATGCAAGGCGTAGGCCCGGCCGTG
ACGCTCCCCAACGCACTGGCGGTACTGGGAACAGCCTATCCGCCGGGCCATCGCAAGGCCATGGTCTTCGCCATG
TTCGGGGCTGTGGCCCCGGTCGGGGCCGTCGTCGGGGGCGTCTTTTCGACCGCAGTCATCGGAATCGTCGCTCTC
GTTCTCTTTAGCTTCGCCTGGACGCAAGCGCCCGTCGACGGCTGGTCCGCGCCATCCGTCCTGGTCCCTCTCGTG
GCAGGCCTCGCCCTCTTCGGCCTCTTCCTCTACACGGAGACGAAGCTGAGCCCGGCACCGCTGGTCCCCCTCCAG
GCTCTAACGGCAGACGTGGGCTTCGTGCTGGCCGCCGTGCTGTTCGGCTGGGCGAGTTTCGGCGTGTGGACGCTG
TATCTCGTGCAGACGCTGCAGGAGGCGCGCGGGTTGTCGCCCCTGATGCTGACGGCTTACTTTTGCCCCGTTGCT
CTATCGGGTGCGACGGCGGCGGTTGCCACGGGCTTGATGCTGGGGCCTCTACGGCTCGGGCCGCCTACTGTCATG
ACGGTCGCCTTGGCTGCCTTTACGATCGGTTCCATACTGACGGCCGTGGCTCCCGTTCATCAGACGTACTGGGCG
CAGCTGTTCGTCGCCTTTCTCGTCATGCCCGTCGGTATGGACTGTTCCTTTCCAGCCTCGACGCTCGTCGTGTCC
AACGCGGTGGCGAGGAGACACCAGGGGGTCGGGGCGAGTCTCGTGAGCACCGTCGTCAACTACGGCATCGCCCTG
GGGGTCGGATTCGCCGGCACGGCGGAGATGTACGTCCGTGGCGATCCGGACACCGTCGAGGGGAGGCTTCGGGGC
AGAAGGATACCGCCCTTTGTGGAATCCGTCGAGCGGGTCAGCCCAGACGTCACCTTCCTGGCGGCCCACGCCTAC
GCCCTCAAACAGGCCATCGACGAGACCATCTTCCTGGTCAAGGAAACGGACAAGCTCAACATGAGGGAGACGCAG
GAGATCCTCGTCGCCCTGGAGAGCGTCAAGATTGAGGGTCATAGGGGCACCGAGGCGCTGGGGAAGCCGAGGGAT
CGGATCAAGGAGTTGAAGTTGTGTGGGTTTATGAGGACGCAGATCTATCAGCTTCAGTACAAGTTTCGCTGGTTG
ATTCCACATCTGCTCGATAAGTTTCCCAAGGCGGCCAAGGGGGTGGGTGGCACTGTGAGGATTACCCTGGAAAGG
TTTCTTGAGGATTGGGCAAAGGCGTATACCTTGTACAATTGCAAGAATGACCTGTATGACACTGCCTAG
Gene >Ophcf2|04541
ATGCTGCAAGATGGCGGCTCGGATACTACGTCGACCAAGATGATGTCGGATTCCAACGCGTCGGAACTCGGCACG
GAGGGGAGGAGGGCTTGGGCTTCGCAGGGGATGAAGCCTTGGAGGGAGGCTTTGTTGGTCTTTACTGCTTGCATG
GCGCAGTTTTGCACTCGTGAGAGACATGTTTGAATTTGAGGGGAGATGCTAATGATGATTGGTGTGTTTGATCAG
AGACGGCCTTCTTTTCTACCCTCATCCTCTTGCGTCCTATCGGCGCCTCGTTCGGTATCGACAGTCCGGCGAGAT
TGGCCTGGCTCGTGGCCGCCTTCTCCCTCGCAGCCGGTACCCTCATCATCTTCTGCGGACGTCTGGGCGATGTCT
TTGGCCACGGCCGGATGCTCATCTTGGGCTTCACCTGGTGGGCTCTCTGGTCCGCCATCTCGGGCCTATCCGTCT
ACTCGACCTTTTACCTCTCCGTCATCTCCCGCGCCATGCAAGGCGTAGGCCCGGCCGTGACGCTCCCCAACGCAC
TGGCGGTACTGGGAACAGCCTATCCGCCGGGCCATCGCAAGGCCATGGTCTTCGCCATGTTCGGGGCTGTGGCCC
CGGTCGGGGCCGTCGTCGGGGGCGTCTTTTCGAGTCTGTTGGCCGAGGTTTGGTGGCCTTGGGCTATGTGGGTTT
TTGCCCTCTGGTTGCTCGTTTTGGCGGTTTTGGCGGGTTTTGCCGTGCCTTTGAGGGACGAGCTTGGAAGGCATG
GTGATGGTGATGGTGATGGTGATGGTGATGGTGACGGTCAAGGTGATGACGATGATGAGAAGCGAGTTGCTTCTT
CTGCGTCGCGTGGGTTGAAGGATACTTTGCTCGCACTCGACGTTCCAGCCGCAGTCATCGGAATCGTCGCTCTCG
TTCTCTTTAGCTTCGCCTGGACGCAAGCGCCCGTCGACGGCTGGTCCGCGCCATCCGTCCTGGTCCCTCTCGTGG
CAGGCCTCGCCCTCTTCGGCCTCTTCCTCTACACGGAGACGAAGCTGAGCCCGGCACCGCTGGTCCCCCTCCAGG
CTCTAACGGCAGACGTGGGCTTCGTGCTGGCCGCCGTGCTGTTCGGCTGGGCGAGTTTCGGCGTGTGGACGCTGT
ATCTCGTGCAGACGCTGCAGGAGGCGCGCGGGTTGTCGCCCCTGATGCTGACGGCTTACTTTTGCCCCGTTGCTC
TATCGGGTGCGACGGCGGCGGTTGCCACGGGCTTGATGCTGGGGCCTCTACGGCTCGGGCCGCCTACTGTCATGA
CGGTCGCCTTGGCTGCCTTTACGATCGGTTCCATACTGACGGCCGTGGCTCCCGTTCATCAGACGTACTGGGCGC
AGCTGTTCGTCGCCTTTCTCGTCATGCCCGTCGGTATGGACTGTTCCTTTCCAGCCTCGACGCTCGTCGTGTCCA
ACGCGGTGGCGAGGAGACACCAGGGGGTCGGGGCGAGTCTCGTGAGCACCGTCGTCAACTACGGCATCGCCCTGG
GGGTCGGATTCGCCGGCACGGCGGAGATGTACGTCCGTGGCGATCCGGACACCGTCGAGGGGAGGCTTCGGGGGT
TCCGGGGGCCTTGTTTGTGGGGGTCGGGCTTGCGGGGTTGGGGTTGGTGGTTTGTTTGGCGTTTGTTGCGAGGGA
AGAGGGGGGTTTAGGAGGGGATCGTGATGGGGGTTGTGATGGGGGGTTGTGATGGGCCTTTGCGTTGAGTTGGGG
GGGGGGTTGCATAGAGCTGGGTTGGCTTGCGATGGGATCTTGGCTAGGCATTGCTAGAGTATATGATGGAGTAAA
ATCGGGGGGATATGGTTGTATAAGGGTAGGAGATGCATGAATGATGATGGATGTTGTTTCAATCGGCAGGATAGC
TCCGTCTAGAGATGTACGGGTAATGCAAGAGGCTCAGCTTTAACTAGACAGAAGTCTATGTAGGGATAGAGCCTT
CCTACGAATGAATACATGCCCATAGAAGGCCAGAGAGTGCTCTGCTCCCCTTGTTTGACGTGGAGCAAACACACA
CACACACACACACACACTTACACACACACTTACACACACACTTACACGGCTCGGAGGCAGCTGACTCGTCGACCT
CTATCTAACATGTGCTCCCGCTCTTGTGCGGGGACTAATGCGCAGATGGTTCTGCTAATGCTTGCCCAAAGTCAG
CTCCGTTGCCTGACCGTCATGACGGGAGTAGTCATGATGTCGGAGGAGGCTGTGCTTGGTTATTTAAGGGGGAGT
GACTACTCGGGAGCTTGTCTGCTGGTTACCCTGGCAGTCTCTTCTCTTTTGCGTGGACGTCATCTTTCAAGCCGA
AGAGACTACAGCTTCTCGTTCCGGAATAGCTTCTTCCCATTCCTCCCAACGTCTACTCGGAAAGCTCGACTTGAT
TATTCACGATGAAATTCTTGCTCCCCCTTTTCTTCCTGGTGGCCGTGGTCACCGCCCGCGAAATCCCCGACGTCT
TCATCGTCAACACGCCCACCAAACTCCGAAAAAGCATCGAAGCCATCAGCAGAAGGATACCGCCCTTTGTGGAAT
CCGTCGAGCGGGTCAGCCCAGACGTCACCTTCCTGGCGGCCCACGCCTACGCCCTCAAACAGGCCATCGACGAGA
CCATCTTCCTGGTCAAGGAAACGGACAAGCTCAACATGAGGGAGACGCAGGAGATCCTCGTCGCCCTGGAGAGCG
TCAAGATTGAGGGTCATAGGGGCACCGAGGCGCTGGGGAAGCCGAGGGATCGGATCAAGGAGTTGAAGTTGTGTG
GGTTTATGAGGACGCAGATCTATCAGCTTCAGTACAAGTTTCGCTGGTTGATTCCACATCTGCTCGATAAGTTTC
CCAAGGCGGCCAAGGGGGTGGGTGGCACTGTGAGGATTACCCTGGAAAGGTTTCTTGAGGATTGGGCAAAGGCGT
ATACCTTGTACAATTGCAAGAATGACCTGTATGACACTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail