Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04536
Gene name
Locationscaffold_04:3515840..3516980
Strand-
Gene length (bp)1140
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09056 Phospholip_A2_3 Prokaryotic phospholipase A2 4.2E-28 133 240

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1282 0.0549 0.9211 0.121 0.1752 0.0319 0.2087 0.1931 0.137 0.0037

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999707

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup191
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2378
Ophiocordyceps australis map64 (Brazil) OphauB2|188
Ophiocordyceps australis map64 (Brazil) OphauB2|3828
Ophiocordyceps camponoti-floridani Ophcf2|04536 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6933
Ophiocordyceps kimflemingae Ophio5|2461
Ophiocordyceps subramaniannii Hirsu2|593
Ophiocordyceps subramaniannii Hirsu2|6486
Ophiocordyceps subramaniannii Hirsu2|9027

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04536
MRFLTFAPLCLAALTSAANKANDTNLLKCWGDDIQPKRLNPEHWFANRFMYQYFLETRTYKPREQSVNLFLKNGG
LYEPINRFFQPEANNDSIDLTSLNFIIINKILSPIEHERLNKDGTAHLNRDAVRMVVDFFVFNTTMEQFQLLARS
KIWKGFDWKTDACTASPDKPYGYDFKWACIRHDFGYRNFRRLGMLSHNWRRKTDMNFLMDMKDVCDASKNPKGCI
HWVAKWYYIAVRVFGLTQVQKVKRSLEPAEMEAQRDANARAAASRLFVLAGLLDEKEKGKHHRSEKLDHLLREAV
FSKDGNFAAGANWTEFLAQDGAWNLTGGRAAGPVRVCRDGMKTARGCGKSSLLVA*
Coding >Ophcf2|04536
ATGAGATTCCTTACCTTTGCTCCTCTCTGCCTCGCAGCCCTCACCTCGGCAGCAAATAAAGCCAACGATACGAAC
CTTCTCAAGTGCTGGGGCGACGACATACAACCCAAGAGGCTGAACCCCGAGCACTGGTTCGCCAACAGATTCATG
TACCAGTATTTCCTCGAGACCAGGACCTATAAGCCCCGAGAACAGTCGGTCAACCTGTTCCTCAAGAACGGGGGT
TTATACGAGCCCATCAACCGCTTCTTCCAGCCGGAAGCAAACAACGACTCCATCGATCTCACGTCGCTCAACTTC
ATCATCATCAACAAGATCCTCTCTCCCATCGAGCACGAGAGGCTGAACAAAGACGGCACGGCTCACCTCAACAGG
GATGCGGTTCGTATGGTTGTCGATTTCTTCGTCTTCAATACTACCATGGAGCAGTTCCAACTTCTAGCGAGAAGC
AAGATCTGGAAGGGCTTCGACTGGAAGACCGATGCCTGCACGGCCTCGCCCGACAAACCGTACGGTTACGACTTC
AAGTGGGCTTGTATACGCCATGACTTTGGCTATCGTAACTTCAGAAGGCTGGGGATGCTATCACACAACTGGAGG
AGAAAGACAGACATGAACTTCTTGATGGACATGAAAGACGTCTGCGATGCGTCCAAAAACCCGAAAGGCTGCATC
CACTGGGTGGCGAAATGGTACTACATAGCCGTCCGCGTCTTCGGCCTAACACAGGTGCAAAAAGTCAAGCGCTCA
CTGGAACCGGCCGAGATGGAAGCCCAGCGGGATGCCAATGCCAGAGCGGCAGCCTCGAGGCTGTTCGTCCTTGCC
GGCCTCCTCGACGAAAAAGAAAAGGGGAAACATCATCGTTCGGAGAAGCTCGATCATCTTCTTCGCGAAGCTGTG
TTTTCCAAGGATGGGAACTTCGCTGCCGGCGCCAACTGGACCGAGTTTCTGGCTCAGGATGGGGCCTGGAACTTG
ACGGGGGGGAGGGCGGCTGGGCCGGTCAGGGTCTGCCGTGATGGGATGAAGACGGCGAGGGGTTGTGGGAAGTCG
AGTCTGCTTGTTGCGTAG
Transcript >Ophcf2|04536
ATGAGATTCCTTACCTTTGCTCCTCTCTGCCTCGCAGCCCTCACCTCGGCAGCAAATAAAGCCAACGATACGAAC
CTTCTCAAGTGCTGGGGCGACGACATACAACCCAAGAGGCTGAACCCCGAGCACTGGTTCGCCAACAGATTCATG
TACCAGTATTTCCTCGAGACCAGGACCTATAAGCCCCGAGAACAGTCGGTCAACCTGTTCCTCAAGAACGGGGGT
TTATACGAGCCCATCAACCGCTTCTTCCAGCCGGAAGCAAACAACGACTCCATCGATCTCACGTCGCTCAACTTC
ATCATCATCAACAAGATCCTCTCTCCCATCGAGCACGAGAGGCTGAACAAAGACGGCACGGCTCACCTCAACAGG
GATGCGGTTCGTATGGTTGTCGATTTCTTCGTCTTCAATACTACCATGGAGCAGTTCCAACTTCTAGCGAGAAGC
AAGATCTGGAAGGGCTTCGACTGGAAGACCGATGCCTGCACGGCCTCGCCCGACAAACCGTACGGTTACGACTTC
AAGTGGGCTTGTATACGCCATGACTTTGGCTATCGTAACTTCAGAAGGCTGGGGATGCTATCACACAACTGGAGG
AGAAAGACAGACATGAACTTCTTGATGGACATGAAAGACGTCTGCGATGCGTCCAAAAACCCGAAAGGCTGCATC
CACTGGGTGGCGAAATGGTACTACATAGCCGTCCGCGTCTTCGGCCTAACACAGGTGCAAAAAGTCAAGCGCTCA
CTGGAACCGGCCGAGATGGAAGCCCAGCGGGATGCCAATGCCAGAGCGGCAGCCTCGAGGCTGTTCGTCCTTGCC
GGCCTCCTCGACGAAAAAGAAAAGGGGAAACATCATCGTTCGGAGAAGCTCGATCATCTTCTTCGCGAAGCTGTG
TTTTCCAAGGATGGGAACTTCGCTGCCGGCGCCAACTGGACCGAGTTTCTGGCTCAGGATGGGGCCTGGAACTTG
ACGGGGGGGAGGGCGGCTGGGCCGGTCAGGGTCTGCCGTGATGGGATGAAGACGGCGAGGGGTTGTGGGAAGTCG
AGTCTGCTTGTTGCGTAG
Gene >Ophcf2|04536
ATGAGATTCCTTACCTTTGCTCCTCTCTGCCTCGCAGCCCTCACCTCGGCAGCAAATAAAGCCAACGATACGAAC
CTTCTCAAGTGCTGGGGCGACGACATACAACCCAAGAGGCTGAACCCCGAGCACTGGTTCGCCAACAGATTCATG
TACCAGTATTTCCTCGAGACCAGGACCTATAAGCCCCGAGAACAGTCGGTCAACCTGTTCCTCAAGAACGGGGGT
TTATACGAGCCCATCAACCGCTTCTTCCAGCCGGAAGCAAACAACGACTCCATCGATCTCACGTCGCTCAACTTC
ATCATCATCAACAAGATCCTCTCTCCCATCGAGCACGAGAGGCTGAACAAAGACGGCACGGCTCACCTCAACAGG
GATGCGGTTCGTATGGTTGTCGATTTCTTCGTCTTCAATACTACCATGGAGCAGTTCCAACTTCTAGCGAGAAGC
AAGATCTGGAAGGGCTTCGACTGGAAGACCGATGCCTGCACGGCCTCGCCCGACAAACCGTACGGTTACGACTTC
AAGTGGGCTTGTATACGCCATGACTTTGGCTATCGTAACTTCAGAAGGCTGGGGATGCTATCACACAACTGGAGG
AGAAAGACAGACATGAACTTCTTGATGGAGTGAGTCCTCCCATCTCCCCTCCCACCCAAAACAACCGTCCACCGT
AACCAACAACAAACAACCCCGAACAGCATGAAAGACGTCTGCGATGCGTCCAAAAACCCGAAAGGCTGCATCCAC
TGGGTGGCGAAATGGTACTACATAGCCGTCCGCGTCTTCGGCCTAACACAGGTGCAAAAAGTCAAGCGCTCACTG
GAACCGGCCGAGATGGAAGCCCAGCGGGATGCCAATGCCAGAGCGGCAGCCTCGAGGCTGTTCGTCCTTGCCGGC
CTCCTCGACGAAAAAGAAAAGGGGAAACATCATCGTTCGGAGAAGCTCGATCATCTTCTTCGCGAAGCTGTGTTT
TCCAAGGATGGGAACTTCGCTGCCGGCGCCAACTGGACCGAGTTTCTGGCTCAGGATGGGGCCTGGAACTTGACG
GGGGGGAGGGCGGCTGGGCCGGTCAGGGTCTGCCGTGATGGGATGAAGACGGCGAGGGGTTGTGGGAAGTCGAGT
CTGCTTGTTGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail