Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04534
Gene name
Locationscaffold_04:3510576..3512139
Strand-
Gene length (bp)1563
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 6.9E-07 234 495

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1736 0.1016 0.8897 0.0941 0.1194 0.1128 0.2351 0.2451 0.2415 0.0175

SignalP

SignalP signal predicted Location Score
Yes 1 - 27 0.999667

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4370
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5833
Ophiocordyceps australis map64 (Brazil) OphauB2|4116
Ophiocordyceps camponoti-floridani Ophcf2|04534 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7161
Ophiocordyceps kimflemingae Ophio5|2459
Ophiocordyceps subramaniannii Hirsu2|9024

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04534
MRPSSSSSSYVTSGLTALFLLFSGASPAPTAPDGSLSWSDAEPLFTFHYSTSQPDGKNWIGLYNSFYGAPDNESY
VANSLAWSYAPEGDGSVKVTPPKNLPPGQYRAFLLARDGYQHLAHPVDVVSGNGSLSFLIDEFTTRNGREGDAFE
VSIKGLLTNQKDTKTKFTKMTSEGDGNDWVTVSGDGTISGKPDASGERRVTIEATSSVGSKAQLKVKIPIRSSGS
SLVDRIGVLSFNMWHGGSQVNDYHRKQVRYLASSNVDIVGLQESNGGHAVRLGQALGWDSWQGRDVGIISRYPIV
ERFDLTQAGGAVRIALDGDASQIIAWNAHLGYTPYGPYDFCYDHMTVEEVMKNEAVSGRTPQIIEIMDRMKTHIA
DSDRVPVLLTGDMNAPSHLDWTEATRSQHCNVGAVPWPSSEEPIKGGLIDSYREVHKDPAADPGITWSPIQLEND
GRPEPLDRIDFVYHKGLKVVDSVREVVGKPEPEPNHWDNEWTTDHAAVRSTFQVPAKQNKRDVVREALKI*
Coding >Ophcf2|04534
ATGCGCCCTTCGTCGTCCAGTTCGTCCTACGTCACGTCCGGCTTGACCGCCCTCTTCCTCCTCTTCAGCGGAGCC
TCTCCAGCCCCGACGGCTCCGGACGGCTCCCTCTCTTGGTCCGACGCCGAGCCTCTCTTCACCTTTCACTACTCG
ACGTCGCAACCGGATGGTAAGAACTGGATCGGCCTGTACAACTCCTTCTACGGCGCGCCCGATAATGAGTCGTAC
GTCGCCAACTCCCTGGCTTGGTCCTACGCCCCGGAAGGCGATGGTAGCGTCAAGGTGACGCCGCCCAAGAACCTG
CCTCCGGGCCAGTACAGGGCCTTTCTCCTCGCCCGCGACGGCTACCAGCATCTCGCCCATCCCGTTGACGTCGTC
TCGGGCAACGGATCTCTGTCGTTCCTGATTGACGAGTTCACGACGCGCAATGGCCGCGAGGGAGACGCCTTCGAG
GTCAGCATCAAGGGCCTCCTTACCAACCAGAAGGACACCAAGACCAAGTTCACCAAGATGACGTCCGAAGGAGAT
GGCAACGACTGGGTCACCGTGTCCGGAGACGGAACCATCAGCGGCAAGCCCGACGCCAGCGGCGAGAGGCGAGTG
ACCATCGAGGCAACGAGCTCCGTCGGATCCAAGGCCCAGCTCAAGGTCAAGATTCCCATCCGCAGCTCGGGCTCG
TCTCTGGTCGATCGTATCGGCGTTCTATCTTTCAACATGTGGCACGGCGGCTCACAGGTCAACGACTACCACCGC
AAGCAGGTCCGCTATCTGGCCAGCAGCAATGTTGACATCGTCGGTCTGCAGGAGAGCAACGGCGGACACGCAGTA
AGACTCGGTCAGGCGCTGGGCTGGGACTCGTGGCAGGGTCGAGACGTCGGCATCATCAGCCGCTACCCCATTGTC
GAGAGATTCGACCTGACGCAGGCCGGAGGAGCGGTACGAATCGCACTCGACGGTGATGCCAGCCAGATCATCGCC
TGGAACGCCCACCTGGGATATACGCCGTACGGGCCGTACGACTTTTGCTACGACCATATGACGGTCGAGGAAGTC
ATGAAGAACGAGGCCGTGTCCGGACGAACGCCGCAGATCATCGAGATCATGGATCGCATGAAGACGCACATCGCC
GACTCGGACCGTGTTCCGGTACTGCTAACGGGCGACATGAACGCGCCCTCTCATCTAGACTGGACCGAGGCAACC
CGAAGCCAGCACTGCAACGTTGGAGCCGTTCCGTGGCCCAGCTCCGAGGAGCCCATCAAGGGGGGCCTCATAGAC
TCGTATCGCGAGGTTCACAAGGACCCAGCCGCCGACCCGGGCATCACCTGGTCTCCCATCCAGCTGGAGAACGAT
GGTCGGCCCGAGCCGCTGGACCGTATCGATTTTGTCTATCACAAGGGGCTCAAGGTGGTTGACTCGGTGCGTGAG
GTGGTTGGAAAGCCGGAGCCGGAGCCGAACCACTGGGATAACGAGTGGACGACGGATCACGCGGCGGTTCGGTCG
ACGTTTCAAGTGCCGGCCAAGCAGAATAAGCGCGATGTGGTCCGAGAGGCGCTGAAGATTTAG
Transcript >Ophcf2|04534
ATGCGCCCTTCGTCGTCCAGTTCGTCCTACGTCACGTCCGGCTTGACCGCCCTCTTCCTCCTCTTCAGCGGAGCC
TCTCCAGCCCCGACGGCTCCGGACGGCTCCCTCTCTTGGTCCGACGCCGAGCCTCTCTTCACCTTTCACTACTCG
ACGTCGCAACCGGATGGTAAGAACTGGATCGGCCTGTACAACTCCTTCTACGGCGCGCCCGATAATGAGTCGTAC
GTCGCCAACTCCCTGGCTTGGTCCTACGCCCCGGAAGGCGATGGTAGCGTCAAGGTGACGCCGCCCAAGAACCTG
CCTCCGGGCCAGTACAGGGCCTTTCTCCTCGCCCGCGACGGCTACCAGCATCTCGCCCATCCCGTTGACGTCGTC
TCGGGCAACGGATCTCTGTCGTTCCTGATTGACGAGTTCACGACGCGCAATGGCCGCGAGGGAGACGCCTTCGAG
GTCAGCATCAAGGGCCTCCTTACCAACCAGAAGGACACCAAGACCAAGTTCACCAAGATGACGTCCGAAGGAGAT
GGCAACGACTGGGTCACCGTGTCCGGAGACGGAACCATCAGCGGCAAGCCCGACGCCAGCGGCGAGAGGCGAGTG
ACCATCGAGGCAACGAGCTCCGTCGGATCCAAGGCCCAGCTCAAGGTCAAGATTCCCATCCGCAGCTCGGGCTCG
TCTCTGGTCGATCGTATCGGCGTTCTATCTTTCAACATGTGGCACGGCGGCTCACAGGTCAACGACTACCACCGC
AAGCAGGTCCGCTATCTGGCCAGCAGCAATGTTGACATCGTCGGTCTGCAGGAGAGCAACGGCGGACACGCAGTA
AGACTCGGTCAGGCGCTGGGCTGGGACTCGTGGCAGGGTCGAGACGTCGGCATCATCAGCCGCTACCCCATTGTC
GAGAGATTCGACCTGACGCAGGCCGGAGGAGCGGTACGAATCGCACTCGACGGTGATGCCAGCCAGATCATCGCC
TGGAACGCCCACCTGGGATATACGCCGTACGGGCCGTACGACTTTTGCTACGACCATATGACGGTCGAGGAAGTC
ATGAAGAACGAGGCCGTGTCCGGACGAACGCCGCAGATCATCGAGATCATGGATCGCATGAAGACGCACATCGCC
GACTCGGACCGTGTTCCGGTACTGCTAACGGGCGACATGAACGCGCCCTCTCATCTAGACTGGACCGAGGCAACC
CGAAGCCAGCACTGCAACGTTGGAGCCGTTCCGTGGCCCAGCTCCGAGGAGCCCATCAAGGGGGGCCTCATAGAC
TCGTATCGCGAGGTTCACAAGGACCCAGCCGCCGACCCGGGCATCACCTGGTCTCCCATCCAGCTGGAGAACGAT
GGTCGGCCCGAGCCGCTGGACCGTATCGATTTTGTCTATCACAAGGGGCTCAAGGTGGTTGACTCGGTGCGTGAG
GTGGTTGGAAAGCCGGAGCCGGAGCCGAACCACTGGGATAACGAGTGGACGACGGATCACGCGGCGGTTCGGTCG
ACGTTTCAAGTGCCGGCCAAGCAGAATAAGCGCGATGTGGTCCGAGAGGCGCTGAAGATTTAG
Gene >Ophcf2|04534
ATGCGCCCTTCGTCGTCCAGTTCGTCCTACGTCACGTCCGGCTTGACCGCCCTCTTCCTCCTCTTCAGCGGAGCC
TCTCCAGCCCCGACGGCTCCGGACGGCTCCCTCTCTTGGTCCGACGCCGAGCCTCTCTTCACCTTTCACTACTCG
ACGTCGCAACCGGATGGTAAGAACTGGATCGGCCTGTACAACTCCTTCTACGGCGCGCCCGATAATGAGTCGTAC
GTCGCCAACTCCCTGGCTTGGTCCTACGCCCCGGAAGGCGATGGTAGCGTCAAGGTGACGCCGCCCAAGAACCTG
CCTCCGGGCCAGTACAGGGCCTTTCTCCTCGCCCGCGACGGCTACCAGCATCTCGCCCATCCCGTTGACGTCGTC
TCGGGCAACGGATCTCTGTCGTTCCTGATTGACGAGTTCACGACGCGCAATGGCCGCGAGGGAGACGCCTTCGAG
GTCAGCATCAAGGGCCTCCTTACCAACCAGAAGGACACCAAGACCAAGTTCACCAAGATGACGTCCGAAGGAGAT
GGCAACGACTGGGTCACCGTGTCCGGAGACGGAACCATCAGCGGCAAGCCCGACGCCAGCGGCGAGAGGCGAGTG
ACCATCGAGGCAACGAGCTCCGTCGGATCCAAGGCCCAGCTCAAGGTCAAGATTCCCATCCGCAGCTCGGGCTCG
TCTCTGGTCGATCGTATCGGCGTTCTATCTTTCAACATGTGGCACGGCGGCTCACAGGTCAACGACTACCACCGC
AAGCAGGTCCGCTATCTGGCCAGCAGCAATGTTGACATCGTCGGTCTGCAGGAGAGCAACGGCGGACACGCAGTA
AGACTCGGTCAGGCGCTGGGCTGGGACTCGTGGCAGGGTCGAGACGTCGGCATCATCAGCCGCTACCCCATTGTC
GAGAGATTCGACCTGACGCAGGCCGGAGGAGCGGTACGAATCGCACTCGACGGTGATGCCAGCCAGATCATCGCC
TGGAACGCCCACCTGGGATATACGCCGTACGGGCCGTACGACTTTTGCTACGACCATATGACGGTCGAGGAAGTC
ATGAAGAACGAGGCCGTGTCCGGACGAACGCCGCAGATCATCGAGATCATGGATCGCATGAAGACGCACATCGCC
GACTCGGACCGTGTTCCGGTACTGCTAACGGGCGACATGAACGCGCCCTCTCATCTAGACTGGACCGAGGCAACC
CGAAGCCAGCACTGCAACGTTGGAGCCGTTCCGTGGCCCAGCTCCGAGGAGCCCATCAAGGGGGGCCTCATAGAC
TCGTATCGCGAGGTTCACAAGGACCCAGCCGCCGACCCGGGCATCACCTGGTCTCCCATCCAGCTGGAGAACGAT
GGTCGGCCCGAGCCGCTGGACCGTATCGATTTTGTCTATCACAAGGGGCTCAAGGTGGTTGACTCGGTGCGTGAG
GTGGTTGGAAAGCCGGAGCCGGAGCCGAACCACTGGGATAACGAGTGGACGACGGATCACGCGGCGGTTCGGTCG
ACGTTTCAAGTGCCGGCCAAGCAGAATAAGCGCGATGTGGTCCGAGAGGCGCTGAAGATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail