Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04529
Gene name
Locationscaffold_04:3498403..3498794
Strand-
Gene length (bp)391
Transcript length (bp)330
Coding sequence length (bp)330
Protein length (aa) 110

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05768 Glrx-like Glutaredoxin-like domain (DUF836) 1.1E-11 12 99

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2838 0.1222 0.0124 0.0675 0.9716 0.0204 0.0757 0.0939 0.0761 0.0365

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5437
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3692
Ophiocordyceps australis map64 (Brazil) OphauB2|2233
Ophiocordyceps camponoti-floridani Ophcf2|04529 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3282
Ophiocordyceps kimflemingae Ophio5|5068
Ophiocordyceps subramaniannii Hirsu2|5977

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04529
MFATRRLLQGCRITFFTRVNCSLCEVAAEALSKVAVTRPFVCRRIDLAGEEGRPWRELYDFDVPVIHISKDTASP
ENVSTASKAIKLMHRFTPSQIEAKMDEVEKSNDH*
Coding >Ophcf2|04529
ATGTTTGCAACGCGCCGCCTCCTCCAAGGCTGCAGAATCACCTTCTTCACACGTGTCAATTGCAGCCTCTGCGAG
GTCGCCGCTGAAGCCCTGTCCAAGGTGGCCGTCACCAGACCCTTTGTCTGCAGACGCATCGATCTGGCCGGAGAA
GAGGGCCGGCCGTGGCGGGAGCTATACGATTTTGACGTTCCGGTCATACACATCAGCAAAGACACGGCCTCGCCA
GAGAACGTATCCACCGCCTCCAAAGCCATCAAACTAATGCACCGATTCACCCCTTCCCAAATCGAAGCCAAGATG
GACGAGGTGGAGAAATCCAACGACCATTGA
Transcript >Ophcf2|04529
ATGTTTGCAACGCGCCGCCTCCTCCAAGGCTGCAGAATCACCTTCTTCACACGTGTCAATTGCAGCCTCTGCGAG
GTCGCCGCTGAAGCCCTGTCCAAGGTGGCCGTCACCAGACCCTTTGTCTGCAGACGCATCGATCTGGCCGGAGAA
GAGGGCCGGCCGTGGCGGGAGCTATACGATTTTGACGTTCCGGTCATACACATCAGCAAAGACACGGCCTCGCCA
GAGAACGTATCCACCGCCTCCAAAGCCATCAAACTAATGCACCGATTCACCCCTTCCCAAATCGAAGCCAAGATG
GACGAGGTGGAGAAATCCAACGACCATTGA
Gene >Ophcf2|04529
ATGTTTGCAACGCGCCGCCTCCTCCAAGGCTGCAGAATCACCTTCTTCACACGTGTCAATTGCAGCCTCTGCGAG
GTCGCCGCTGAAGCCCTGTCCAAGGTGGCCGTCACCAGACCCTTTGTCTGCAGACGCATCGATCTGGCCGGAGAA
GAGGGCCGGCCGTGGCGGGAGCTATACGATTTTGACGTTCCGGTCGTGAGTGACTCTATCTGTGCTCAACCATAT
CTCGATAATCAGTGCTGACGGGCAGTCTTAGATACACATCAGCAAAGACACGGCCTCGCCAGAGAACGTATCCAC
CGCCTCCAAAGCCATCAAACTAATGCACCGATTCACCCCTTCCCAAATCGAAGCCAAGATGGACGAGGTGGAGAA
ATCCAACGACCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail