Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04524
Gene name
Locationscaffold_04:3491353..3493305
Strand-
Gene length (bp)1952
Transcript length (bp)1890
Coding sequence length (bp)1890
Protein length (aa) 630

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11700 ATG22 Vacuole effluxer Atg22 like 6.3E-195 57 590

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 62 84 22
2 131 153 22
3 166 185 19
4 189 211 22
5 301 323 22
6 333 352 19
7 394 416 22
8 426 448 22
9 461 483 22
10 498 520 22
11 532 554 22
12 564 581 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04524
MPSPEADFSPAVCPKPSLQVRSGSSDEADDERSDSDAEMASSGLPSPRYPGYDARPTSRKELFGWYMYAFAAETY
VICGIASFIPILLESLARENGVLLSDPTKTCGSSDSKTEKDDGQCVVYVLGLQINTASFAMYTFSLSVALQALLV
VSISCAADHGNYRKKLLLAFAWIGALAVMSYIFIGKETYLLGAILTIISNTSFGASFVLLNSFLPLLVRNHPHVI
GARGAHTPDLAATGFESRPLEDPVEGELEPPAMANSTSALLPDDEESAAWRLKRDATPEDMTSKELQLSTRLSAR
GIGVGYSAALFVQCISIAILIWMKNTTWAQRVVLFFVGTWWCLFTVPAALWLRPRPGPPLAGDGSLSCVSYLTYA
WKSLWRTVKLLRRLVDISLFLAGWFLLSDAIATTSSTAILFAKTHLHMPPWALGMINVIVTLTGVLGAFGWSWVS
RVWGIQAHQTILVCIGLFELIPLYGLLGYIPFVERWGVVGLQRPWEMYPLAAIYGLVMGGLSSYCRSLYGELIPP
GSEAAFYALYAITDKGSSVFGPTIVGAIIDGTGSIRPAFWFLAVLVGLPAPLIWFIDVERGKREADGLAGTIEGL
TVARTGDGGMGDEGGGMMADYDGDGQLRR*
Coding >Ophcf2|04524
ATGCCGTCGCCCGAGGCAGACTTCTCGCCAGCCGTCTGTCCCAAGCCCTCGCTACAAGTGCGCTCCGGCTCCTCG
GACGAGGCCGACGACGAGCGCTCTGATTCGGATGCTGAAATGGCTTCCTCTGGGCTTCCGTCTCCGCGATATCCG
GGCTACGATGCGCGTCCGACCAGTCGCAAAGAGCTGTTCGGCTGGTACATGTATGCCTTTGCCGCCGAGACGTAT
GTCATCTGCGGCATCGCCTCCTTCATACCCATACTGCTCGAGTCGCTGGCGCGCGAAAACGGCGTGCTCCTCTCC
GACCCGACCAAGACATGCGGCTCGAGCGATAGCAAGACGGAGAAAGACGACGGTCAGTGCGTCGTCTACGTTCTC
GGACTACAGATCAACACGGCCAGCTTCGCCATGTACACCTTTTCCCTCAGCGTCGCGCTGCAGGCTCTCCTCGTC
GTCAGCATCAGCTGCGCGGCCGACCACGGTAACTATCGCAAGAAGCTCCTTCTCGCCTTTGCCTGGATCGGCGCC
TTGGCCGTCATGTCTTACATCTTCATCGGCAAGGAGACGTACCTCCTCGGCGCCATCCTCACCATTATATCCAAC
ACGTCCTTCGGCGCGTCTTTTGTCCTGCTCAATTCTTTCCTGCCGCTGCTGGTGAGGAACCATCCCCACGTTATT
GGCGCCCGGGGAGCGCATACGCCTGATCTGGCGGCCACGGGGTTTGAATCGCGTCCGCTCGAGGATCCGGTTGAA
GGCGAGTTGGAGCCGCCGGCCATGGCCAACTCTACCTCGGCGCTGTTGCCTGACGACGAGGAGTCGGCTGCCTGG
CGTCTCAAGCGGGACGCGACGCCCGAGGACATGACGTCCAAGGAGCTGCAGCTGTCGACGCGTCTGTCGGCTCGG
GGAATCGGCGTCGGTTATAGTGCGGCCCTCTTCGTTCAGTGCATCTCCATCGCCATCTTGATTTGGATGAAGAAC
ACCACCTGGGCTCAGCGCGTCGTCCTCTTCTTCGTCGGTACCTGGTGGTGCCTCTTCACCGTCCCGGCTGCCCTC
TGGTTGCGGCCCAGGCCTGGACCTCCCTTGGCTGGTGACGGCAGTCTCTCGTGCGTCTCGTACCTGACGTACGCG
TGGAAGTCGCTGTGGCGGACGGTCAAACTCCTCCGTCGCCTGGTGGATATCTCCTTGTTCCTGGCAGGCTGGTTC
CTCCTGTCGGATGCCATTGCGACGACATCGTCGACGGCGATTCTCTTCGCCAAGACGCACCTACACATGCCTCCG
TGGGCTCTGGGCATGATCAACGTCATCGTCACGCTGACGGGCGTCCTGGGAGCCTTTGGGTGGTCGTGGGTGTCG
CGCGTCTGGGGCATCCAGGCCCACCAGACGATATTGGTCTGCATCGGCCTCTTCGAGCTGATACCCCTGTACGGG
CTCCTGGGCTACATCCCCTTCGTCGAGAGATGGGGCGTCGTCGGCCTCCAGCGGCCGTGGGAGATGTACCCGCTG
GCGGCCATCTACGGCCTCGTCATGGGCGGTCTGAGCAGCTACTGCCGGTCGCTGTACGGGGAGCTGATACCGCCG
GGGTCCGAGGCCGCCTTTTACGCTCTGTACGCCATCACGGACAAGGGCTCGAGCGTGTTCGGGCCGACGATTGTG
GGCGCCATCATCGATGGCACCGGGAGCATCCGGCCGGCGTTTTGGTTCCTGGCGGTGCTGGTGGGGCTCCCGGCG
CCGCTGATCTGGTTCATCGACGTCGAGAGGGGGAAGAGGGAGGCTGATGGGCTGGCTGGGACGATTGAGGGCCTC
ACGGTGGCGAGGACGGGGGATGGGGGGATGGGGGATGAGGGTGGGGGCATGATGGCTGACTATGACGGCGACGGG
CAGCTCAGGAGATGA
Transcript >Ophcf2|04524
ATGCCGTCGCCCGAGGCAGACTTCTCGCCAGCCGTCTGTCCCAAGCCCTCGCTACAAGTGCGCTCCGGCTCCTCG
GACGAGGCCGACGACGAGCGCTCTGATTCGGATGCTGAAATGGCTTCCTCTGGGCTTCCGTCTCCGCGATATCCG
GGCTACGATGCGCGTCCGACCAGTCGCAAAGAGCTGTTCGGCTGGTACATGTATGCCTTTGCCGCCGAGACGTAT
GTCATCTGCGGCATCGCCTCCTTCATACCCATACTGCTCGAGTCGCTGGCGCGCGAAAACGGCGTGCTCCTCTCC
GACCCGACCAAGACATGCGGCTCGAGCGATAGCAAGACGGAGAAAGACGACGGTCAGTGCGTCGTCTACGTTCTC
GGACTACAGATCAACACGGCCAGCTTCGCCATGTACACCTTTTCCCTCAGCGTCGCGCTGCAGGCTCTCCTCGTC
GTCAGCATCAGCTGCGCGGCCGACCACGGTAACTATCGCAAGAAGCTCCTTCTCGCCTTTGCCTGGATCGGCGCC
TTGGCCGTCATGTCTTACATCTTCATCGGCAAGGAGACGTACCTCCTCGGCGCCATCCTCACCATTATATCCAAC
ACGTCCTTCGGCGCGTCTTTTGTCCTGCTCAATTCTTTCCTGCCGCTGCTGGTGAGGAACCATCCCCACGTTATT
GGCGCCCGGGGAGCGCATACGCCTGATCTGGCGGCCACGGGGTTTGAATCGCGTCCGCTCGAGGATCCGGTTGAA
GGCGAGTTGGAGCCGCCGGCCATGGCCAACTCTACCTCGGCGCTGTTGCCTGACGACGAGGAGTCGGCTGCCTGG
CGTCTCAAGCGGGACGCGACGCCCGAGGACATGACGTCCAAGGAGCTGCAGCTGTCGACGCGTCTGTCGGCTCGG
GGAATCGGCGTCGGTTATAGTGCGGCCCTCTTCGTTCAGTGCATCTCCATCGCCATCTTGATTTGGATGAAGAAC
ACCACCTGGGCTCAGCGCGTCGTCCTCTTCTTCGTCGGTACCTGGTGGTGCCTCTTCACCGTCCCGGCTGCCCTC
TGGTTGCGGCCCAGGCCTGGACCTCCCTTGGCTGGTGACGGCAGTCTCTCGTGCGTCTCGTACCTGACGTACGCG
TGGAAGTCGCTGTGGCGGACGGTCAAACTCCTCCGTCGCCTGGTGGATATCTCCTTGTTCCTGGCAGGCTGGTTC
CTCCTGTCGGATGCCATTGCGACGACATCGTCGACGGCGATTCTCTTCGCCAAGACGCACCTACACATGCCTCCG
TGGGCTCTGGGCATGATCAACGTCATCGTCACGCTGACGGGCGTCCTGGGAGCCTTTGGGTGGTCGTGGGTGTCG
CGCGTCTGGGGCATCCAGGCCCACCAGACGATATTGGTCTGCATCGGCCTCTTCGAGCTGATACCCCTGTACGGG
CTCCTGGGCTACATCCCCTTCGTCGAGAGATGGGGCGTCGTCGGCCTCCAGCGGCCGTGGGAGATGTACCCGCTG
GCGGCCATCTACGGCCTCGTCATGGGCGGTCTGAGCAGCTACTGCCGGTCGCTGTACGGGGAGCTGATACCGCCG
GGGTCCGAGGCCGCCTTTTACGCTCTGTACGCCATCACGGACAAGGGCTCGAGCGTGTTCGGGCCGACGATTGTG
GGCGCCATCATCGATGGCACCGGGAGCATCCGGCCGGCGTTTTGGTTCCTGGCGGTGCTGGTGGGGCTCCCGGCG
CCGCTGATCTGGTTCATCGACGTCGAGAGGGGGAAGAGGGAGGCTGATGGGCTGGCTGGGACGATTGAGGGCCTC
ACGGTGGCGAGGACGGGGGATGGGGGGATGGGGGATGAGGGTGGGGGCATGATGGCTGACTATGACGGCGACGGG
CAGCTCAGGAGATGA
Gene >Ophcf2|04524
ATGCCGTCGCCCGAGGCAGACTTCTCGCCAGCCGTCTGTCCCAAGCCCTCGCTACAAGTGCGCTCCGGCTCCTCG
GACGAGGCCGACGACGAGCGCTCTGATTCGGATGCTGAAATGGCTTCCTCTGGGCTTCCGTCTCCGCGATATCCG
GGCTACGATGCGCGTCCGACCAGTCGCAAAGAGCTGTTCGGCTGGTACATGTATGCCTTTGCCGCCGAGACGTAT
GTCATCTGCGGCATCGGTGAGTCCTAAGCTGCTGCAATCTGGTCCCGTCTTCGTCTGACGCCGTCTGTCTATCGC
CAGCCTCCTTCATACCCATACTGCTCGAGTCGCTGGCGCGCGAAAACGGCGTGCTCCTCTCCGACCCGACCAAGA
CATGCGGCTCGAGCGATAGCAAGACGGAGAAAGACGACGGTCAGTGCGTCGTCTACGTTCTCGGACTACAGATCA
ACACGGCCAGCTTCGCCATGTACACCTTTTCCCTCAGCGTCGCGCTGCAGGCTCTCCTCGTCGTCAGCATCAGCT
GCGCGGCCGACCACGGTAACTATCGCAAGAAGCTCCTTCTCGCCTTTGCCTGGATCGGCGCCTTGGCCGTCATGT
CTTACATCTTCATCGGCAAGGAGACGTACCTCCTCGGCGCCATCCTCACCATTATATCCAACACGTCCTTCGGCG
CGTCTTTTGTCCTGCTCAATTCTTTCCTGCCGCTGCTGGTGAGGAACCATCCCCACGTTATTGGCGCCCGGGGAG
CGCATACGCCTGATCTGGCGGCCACGGGGTTTGAATCGCGTCCGCTCGAGGATCCGGTTGAAGGCGAGTTGGAGC
CGCCGGCCATGGCCAACTCTACCTCGGCGCTGTTGCCTGACGACGAGGAGTCGGCTGCCTGGCGTCTCAAGCGGG
ACGCGACGCCCGAGGACATGACGTCCAAGGAGCTGCAGCTGTCGACGCGTCTGTCGGCTCGGGGAATCGGCGTCG
GTTATAGTGCGGCCCTCTTCGTTCAGTGCATCTCCATCGCCATCTTGATTTGGATGAAGAACACCACCTGGGCTC
AGCGCGTCGTCCTCTTCTTCGTCGGTACCTGGTGGTGCCTCTTCACCGTCCCGGCTGCCCTCTGGTTGCGGCCCA
GGCCTGGACCTCCCTTGGCTGGTGACGGCAGTCTCTCGTGCGTCTCGTACCTGACGTACGCGTGGAAGTCGCTGT
GGCGGACGGTCAAACTCCTCCGTCGCCTGGTGGATATCTCCTTGTTCCTGGCAGGCTGGTTCCTCCTGTCGGATG
CCATTGCGACGACATCGTCGACGGCGATTCTCTTCGCCAAGACGCACCTACACATGCCTCCGTGGGCTCTGGGCA
TGATCAACGTCATCGTCACGCTGACGGGCGTCCTGGGAGCCTTTGGGTGGTCGTGGGTGTCGCGCGTCTGGGGCA
TCCAGGCCCACCAGACGATATTGGTCTGCATCGGCCTCTTCGAGCTGATACCCCTGTACGGGCTCCTGGGCTACA
TCCCCTTCGTCGAGAGATGGGGCGTCGTCGGCCTCCAGCGGCCGTGGGAGATGTACCCGCTGGCGGCCATCTACG
GCCTCGTCATGGGCGGTCTGAGCAGCTACTGCCGGTCGCTGTACGGGGAGCTGATACCGCCGGGGTCCGAGGCCG
CCTTTTACGCTCTGTACGCCATCACGGACAAGGGCTCGAGCGTGTTCGGGCCGACGATTGTGGGCGCCATCATCG
ATGGCACCGGGAGCATCCGGCCGGCGTTTTGGTTCCTGGCGGTGCTGGTGGGGCTCCCGGCGCCGCTGATCTGGT
TCATCGACGTCGAGAGGGGGAAGAGGGAGGCTGATGGGCTGGCTGGGACGATTGAGGGCCTCACGGTGGCGAGGA
CGGGGGATGGGGGGATGGGGGATGAGGGTGGGGGCATGATGGCTGACTATGACGGCGACGGGCAGCTCAGGAGAT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail