Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04515
Gene name
Locationscaffold_04:3459342..3460376
Strand-
Gene length (bp)1034
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation 2.3E-32 203 301
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 7.2E-10 56 131

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Mitochondrion Mitochondrial transit peptide 0.4898 0.4248 0.0148 0.0757 0.7753 0.1494 0.2023 0.2635 0.1631 0.1842

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup580
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2902
Ophiocordyceps australis 1348a (Ghana) OphauG2|2904
Ophiocordyceps australis map64 (Brazil) OphauB2|2035
Ophiocordyceps australis map64 (Brazil) OphauB2|772
Ophiocordyceps camponoti-floridani Ophcf2|04515 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5636
Ophiocordyceps kimflemingae Ophio5|186
Ophiocordyceps subramaniannii Hirsu2|608

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04515
MASSDLTMAVLGCGTMGIAILNGVLTSLSEPKPLPTPSPSGESTPAEELPAVLPSRFIACVRSAQSAERVAVSLK
AHSSVVTIMRDRNIEAVSQAQVVLLACKPYMVDKVLGEAGMADALRGKLLVSICAGISIEQLTKTLYGNHTPSHD
DCRFVRAMCNTAALIRESMTVIGISDPPMSPADKALVTWIFKRVGDVVCLPNSAMDVSTAIVGSAPAMFSLMLEA
AVDGAVAMGLPRADAQKMATQAMRGAAGLVQAGEHPTKLREKVSTPGGCTIGGLLVLEEGGVRGSVSRAIRETTC
IASQLGQGIQGVNGTRPPLDPKKL*
Coding >Ophcf2|04515
ATGGCCTCGTCAGACCTTACAATGGCCGTCCTGGGCTGCGGCACCATGGGCATCGCCATCCTCAACGGCGTCCTC
ACCTCCCTCTCCGAACCCAAGCCGCTACCGACGCCCTCGCCATCAGGCGAATCAACCCCAGCCGAAGAGCTACCG
GCGGTGCTCCCCTCGCGCTTCATCGCGTGCGTACGCAGCGCCCAGAGCGCCGAGCGAGTGGCCGTCAGTCTAAAA
GCGCACTCATCCGTCGTCACCATTATGCGCGACCGCAATATCGAGGCCGTATCGCAGGCACAGGTTGTTCTCCTC
GCTTGCAAGCCCTACATGGTCGACAAGGTGCTGGGCGAGGCTGGAATGGCCGACGCGCTTCGGGGCAAGCTACTC
GTCAGCATCTGCGCCGGAATCTCCATCGAGCAATTGACGAAGACATTGTACGGAAATCACACTCCCTCTCACGAC
GACTGCCGCTTCGTCCGCGCCATGTGCAACACCGCCGCCCTGATCCGCGAATCCATGACCGTCATTGGCATCAGC
GACCCTCCCATGTCGCCAGCAGACAAGGCGCTCGTCACCTGGATCTTCAAGCGCGTCGGTGACGTCGTTTGCCTT
CCCAATAGCGCCATGGACGTCTCCACCGCCATCGTCGGCTCTGCGCCCGCCATGTTCTCCCTCATGCTAGAGGCT
GCCGTCGACGGCGCAGTCGCCATGGGCCTCCCCCGCGCCGATGCGCAGAAGATGGCCACACAAGCCATGCGTGGC
GCCGCTGGCCTCGTTCAGGCTGGTGAGCACCCGACTAAGCTCAGGGAAAAGGTCTCGACGCCTGGCGGCTGCACC
ATTGGCGGCCTCCTCGTCCTCGAAGAAGGTGGCGTTCGCGGAAGCGTGTCTCGGGCCATCCGTGAAACGACGTGC
ATCGCCAGCCAGCTCGGTCAGGGAATTCAGGGAGTCAACGGGACCAGACCACCTCTGGATCCGAAAAAACTGTGA
Transcript >Ophcf2|04515
ATGGCCTCGTCAGACCTTACAATGGCCGTCCTGGGCTGCGGCACCATGGGCATCGCCATCCTCAACGGCGTCCTC
ACCTCCCTCTCCGAACCCAAGCCGCTACCGACGCCCTCGCCATCAGGCGAATCAACCCCAGCCGAAGAGCTACCG
GCGGTGCTCCCCTCGCGCTTCATCGCGTGCGTACGCAGCGCCCAGAGCGCCGAGCGAGTGGCCGTCAGTCTAAAA
GCGCACTCATCCGTCGTCACCATTATGCGCGACCGCAATATCGAGGCCGTATCGCAGGCACAGGTTGTTCTCCTC
GCTTGCAAGCCCTACATGGTCGACAAGGTGCTGGGCGAGGCTGGAATGGCCGACGCGCTTCGGGGCAAGCTACTC
GTCAGCATCTGCGCCGGAATCTCCATCGAGCAATTGACGAAGACATTGTACGGAAATCACACTCCCTCTCACGAC
GACTGCCGCTTCGTCCGCGCCATGTGCAACACCGCCGCCCTGATCCGCGAATCCATGACCGTCATTGGCATCAGC
GACCCTCCCATGTCGCCAGCAGACAAGGCGCTCGTCACCTGGATCTTCAAGCGCGTCGGTGACGTCGTTTGCCTT
CCCAATAGCGCCATGGACGTCTCCACCGCCATCGTCGGCTCTGCGCCCGCCATGTTCTCCCTCATGCTAGAGGCT
GCCGTCGACGGCGCAGTCGCCATGGGCCTCCCCCGCGCCGATGCGCAGAAGATGGCCACACAAGCCATGCGTGGC
GCCGCTGGCCTCGTTCAGGCTGGTGAGCACCCGACTAAGCTCAGGGAAAAGGTCTCGACGCCTGGCGGCTGCACC
ATTGGCGGCCTCCTCGTCCTCGAAGAAGGTGGCGTTCGCGGAAGCGTGTCTCGGGCCATCCGTGAAACGACGTGC
ATCGCCAGCCAGCTCGGTCAGGGAATTCAGGGAGTCAACGGGACCAGACCACCTCTGGATCCGAAAAAACTGTGA
Gene >Ophcf2|04515
ATGGCCTCGTCAGACCTTACAATGGCCGTCCTGGGCTGCGGTACGTCGACGGCGCAATCCTCCGTTCCCTGCTCG
CCTTCTCATGAGACCCGACTGCAGGCACCATGGGCATCGCCATCCTCAACGGCGTCCTCACCTCCCTCTCCGAAC
CCAAGCCGCTACCGACGCCCTCGCCATCAGGCGAATCAACCCCAGCCGAAGAGCTACCGGCGGTGCTCCCCTCGC
GCTTCATCGCGTGCGTACGCAGCGCCCAGAGCGCCGAGCGAGTGGCCGTCAGTCTAAAAGCGCACTCATCCGTCG
TCACCATTATGCGCGACCGCAATATCGAGGCCGTATCGCAGGCACAGGTTGTTCTCCTCGCTTGCAAGCCCTACA
TGGTCGACAAGGTGCTGGGCGAGGCTGGAATGGCCGACGCGCTTCGGGGCAAGCTACTCGTCAGCATCTGCGCCG
GAATCTCCATCGAGCAATTGACGAAGACATTGTACGGAAATCACACTCCCTCTCACGACGACTGCCGCTTCGTCC
GCGCCATGTGCAACACCGCCGCCCTGATCCGCGAATCCATGACCGTCATTGGCATCAGCGACCCTCCCATGTCGC
CAGCAGACAAGGCGCTCGTCACCTGGATCTTCAAGCGCGTCGGTGACGTCGTTTGCCTTCCCAATAGCGCCATGG
ACGTCTCCACCGCCATCGTCGGCTCTGCGCCCGCCATGTTCTCCCTCATGCTAGAGGCTGCCGTCGACGGCGCAG
TCGCCATGGGCCTCCCCCGCGCCGATGCGCAGAAGATGGCCACACAAGCCATGCGTGGCGCCGCTGGCCTCGTTC
AGGCTGGTGAGCACCCGACTAAGCTCAGGGAAAAGGTCTCGACGCCTGGCGGCTGCACCATTGGCGGCCTCCTCG
TCCTCGAAGAAGGTGGCGTTCGCGGAAGCGTGTCTCGGGCCATCCGTGAAACGACGTGCATCGCCAGCCAGCTCG
GTCAGGGAATTCAGGGAGTCAACGGGACCAGACCACCTCTGGATCCGAAAAAACTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail