Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04514
Gene name
Locationscaffold_04:3457582..3459133
Strand+
Gene length (bp)1551
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus 8.1E-43 10 169

GO

GO Term Description Terminal node
GO:0006325 chromatin organization Yes
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0016043 cellular component organization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2676 0.8555 0.0761 0.0124 0.1208 0.0019 0.035 0.0188 0.0252 0.0022

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3305
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7172
Ophiocordyceps australis map64 (Brazil) OphauB2|773
Ophiocordyceps camponoti-floridani Ophcf2|04514 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5637
Ophiocordyceps kimflemingae Ophio5|187
Ophiocordyceps subramaniannii Hirsu2|609

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04514
MASLPDHAEWLTDSNKAVSISLVSPTANGFLPVAKFHPKFTYPFFGEDEKIFGYKGLNISLRFRANDMRPHLQVS
YEKKVKPSAGLGEPLDVVAVLRDGNFLPPVAFTNESDFDASSKLLADKWTPPGTLYSTINDADCQYEVWAGSLAD
EAIQQLNNRIQILVALFIEAGSYIGRTADSEDNEPNLSDADRWTVFVLYKTEPSTEKADKKSYTFVGFAAVYRFF
YFKAPSSPATDWELPMEQLNLADLPCRTRIAHFVILPPFQAKGNGARLYKTIFDYYQQHSATQELTVESPSEAFD
DLRDVCDLAFLRSVPEFNALSLDASAKLPESGKLPPLVVGSDKLELIRKKTKIAPRQFGRVLEMHLMSQLPDSVQ
PTLEYDENLPTPTKEDKHLEKIWKLFVQQRLFRHNAELISQIEPSQRIEKLRETLGSVELEYARLLAAYERASKP
RLQPTGKRPLDAEPEAPNKKARVEGPQG*
Coding >Ophcf2|04514
ATGGCTTCGCTGCCCGACCACGCTGAGTGGCTGACGGACTCCAACAAGGCCGTCTCCATCTCCCTCGTCTCTCCC
ACGGCAAATGGCTTCCTCCCCGTCGCCAAGTTTCACCCCAAGTTTACCTATCCCTTTTTCGGCGAAGATGAGAAG
ATCTTTGGATACAAGGGTCTGAACATAAGCCTTCGATTCCGTGCCAACGATATGCGCCCTCACCTGCAAGTCTCC
TACGAAAAGAAAGTGAAGCCATCTGCCGGTCTCGGTGAGCCGCTCGACGTGGTTGCCGTCTTGCGAGACGGAAAT
TTCCTGCCTCCTGTCGCCTTTACCAACGAATCTGATTTCGATGCCAGTTCCAAGCTGCTCGCCGACAAATGGACG
CCTCCAGGAACTCTTTACTCGACCATCAATGACGCCGACTGCCAATACGAAGTATGGGCGGGAAGTCTGGCCGAT
GAAGCCATTCAGCAGCTCAACAACCGCATCCAAATTTTGGTTGCTCTCTTTATCGAAGCGGGCTCCTACATCGGG
CGGACGGCCGATTCGGAGGACAACGAGCCTAACCTCTCCGATGCCGATCGCTGGACCGTCTTTGTGCTCTACAAG
ACAGAGCCGTCCACAGAAAAGGCCGACAAGAAATCGTACACCTTTGTTGGCTTCGCAGCCGTCTACCGCTTCTTT
TACTTCAAGGCACCCTCGTCCCCAGCAACCGACTGGGAGTTGCCCATGGAGCAGCTCAACCTGGCCGACCTGCCG
TGCCGCACCAGAATCGCGCACTTTGTCATCTTGCCGCCCTTCCAAGCCAAAGGCAACGGCGCTCGCCTTTACAAG
ACCATCTTCGATTACTACCAGCAGCACTCCGCGACGCAGGAGCTCACAGTCGAGAGTCCCAGCGAAGCATTCGAC
GACCTCCGAGACGTCTGCGATCTGGCTTTTCTTCGCTCCGTGCCCGAGTTCAACGCGCTCAGCCTCGACGCCTCA
GCAAAGTTGCCGGAATCCGGCAAACTGCCTCCTCTGGTCGTCGGCAGTGATAAGCTCGAGCTCATAAGGAAAAAA
ACCAAGATTGCGCCTCGCCAGTTCGGTCGAGTCCTTGAGATGCATCTCATGTCCCAGCTGCCGGACTCGGTTCAG
CCGACATTGGAATACGACGAAAACCTTCCAACCCCTACCAAAGAAGACAAGCATCTGGAGAAGATCTGGAAGCTG
TTTGTCCAGCAGAGGCTCTTTCGTCACAACGCAGAGCTCATATCACAAATTGAACCGTCGCAGCGCATCGAGAAG
CTACGCGAGACGTTGGGCAGCGTCGAGCTCGAATACGCCCGGTTGCTGGCTGCCTACGAGCGAGCGTCGAAACCA
CGACTGCAACCCACTGGCAAGCGTCCGCTGGATGCCGAACCAGAGGCACCCAACAAAAAGGCGAGAGTTGAGGGC
CCACAAGGGTAG
Transcript >Ophcf2|04514
ATGGCTTCGCTGCCCGACCACGCTGAGTGGCTGACGGACTCCAACAAGGCCGTCTCCATCTCCCTCGTCTCTCCC
ACGGCAAATGGCTTCCTCCCCGTCGCCAAGTTTCACCCCAAGTTTACCTATCCCTTTTTCGGCGAAGATGAGAAG
ATCTTTGGATACAAGGGTCTGAACATAAGCCTTCGATTCCGTGCCAACGATATGCGCCCTCACCTGCAAGTCTCC
TACGAAAAGAAAGTGAAGCCATCTGCCGGTCTCGGTGAGCCGCTCGACGTGGTTGCCGTCTTGCGAGACGGAAAT
TTCCTGCCTCCTGTCGCCTTTACCAACGAATCTGATTTCGATGCCAGTTCCAAGCTGCTCGCCGACAAATGGACG
CCTCCAGGAACTCTTTACTCGACCATCAATGACGCCGACTGCCAATACGAAGTATGGGCGGGAAGTCTGGCCGAT
GAAGCCATTCAGCAGCTCAACAACCGCATCCAAATTTTGGTTGCTCTCTTTATCGAAGCGGGCTCCTACATCGGG
CGGACGGCCGATTCGGAGGACAACGAGCCTAACCTCTCCGATGCCGATCGCTGGACCGTCTTTGTGCTCTACAAG
ACAGAGCCGTCCACAGAAAAGGCCGACAAGAAATCGTACACCTTTGTTGGCTTCGCAGCCGTCTACCGCTTCTTT
TACTTCAAGGCACCCTCGTCCCCAGCAACCGACTGGGAGTTGCCCATGGAGCAGCTCAACCTGGCCGACCTGCCG
TGCCGCACCAGAATCGCGCACTTTGTCATCTTGCCGCCCTTCCAAGCCAAAGGCAACGGCGCTCGCCTTTACAAG
ACCATCTTCGATTACTACCAGCAGCACTCCGCGACGCAGGAGCTCACAGTCGAGAGTCCCAGCGAAGCATTCGAC
GACCTCCGAGACGTCTGCGATCTGGCTTTTCTTCGCTCCGTGCCCGAGTTCAACGCGCTCAGCCTCGACGCCTCA
GCAAAGTTGCCGGAATCCGGCAAACTGCCTCCTCTGGTCGTCGGCAGTGATAAGCTCGAGCTCATAAGGAAAAAA
ACCAAGATTGCGCCTCGCCAGTTCGGTCGAGTCCTTGAGATGCATCTCATGTCCCAGCTGCCGGACTCGGTTCAG
CCGACATTGGAATACGACGAAAACCTTCCAACCCCTACCAAAGAAGACAAGCATCTGGAGAAGATCTGGAAGCTG
TTTGTCCAGCAGAGGCTCTTTCGTCACAACGCAGAGCTCATATCACAAATTGAACCGTCGCAGCGCATCGAGAAG
CTACGCGAGACGTTGGGCAGCGTCGAGCTCGAATACGCCCGGTTGCTGGCTGCCTACGAGCGAGCGTCGAAACCA
CGACTGCAACCCACTGGCAAGCGTCCGCTGGATGCCGAACCAGAGGCACCCAACAAAAAGGCGAGAGTTGAGGGC
CCACAAGGGTAG
Gene >Ophcf2|04514
ATGGCTTCGCTGCCCGACCACGCTGAGTGTCGGTCTCTTCTCTCTGCAGCTTCGCCATACGCCTTTGCTAACTAA
ACCCCTTGATCAGGGCTGACGGACTCCAACAAGGCCGTCTCCATCTCCCTCGTCTCTCCCACGGCAAATGGCTTC
CTCCCCGTCGCCAAGTTTCACCCCAAGTTTACCTATCCCTTTTTCGGCGAAGATGAGAAGATCTTTGGATACAAG
GGTCTGAACATAAGCCTTCGATTCCGTGCCAACGATATGCGCCCTCACCTGCAAGTCTCCTACGAAAAGAAAGTG
AAGCCATCTGCCGGTCTCGGTGAGCCGCTCGACGTGGTTGCCGTCTTGCGAGACGGAAATTTCCTGCCTCCTGGT
TCGCTATTTCCATCAAAAAACCCCCAAGCTAGTTGACTGATGGAGCATTCAGTCGCCTTTACCAACGAATCTGAT
TTCGATGCCAGTTCCAAGCTGCTCGCCGACAAATGGACGCCTCCAGGAACTCTTTACTCGACCATCAATGACGCC
GACTGCCAATACGAAGTATGGGCGGGAAGTCTGGCCGATGAAGCCATTCAGCAGCTCAACAACCGCATCCAAATT
TTGGTTGCTCTCTTTATCGAAGCGGGCTCCTACATCGGGCGGACGGCCGATTCGGAGGACAACGAGCCTAACCTC
TCCGATGCCGATCGCTGGACCGTCTTTGTGCTCTACAAGACAGAGCCGTCCACAGAAAAGGCCGACAAGAAATCG
TACACCTTTGTTGGCTTCGCAGCCGTCTACCGCTTCTTTTACTTCAAGGCACCCTCGTCCCCAGCAACCGACTGG
GAGTTGCCCATGGAGCAGCTCAACCTGGCCGACCTGCCGTGCCGCACCAGAATCGCGCACTTTGTCATCTTGCCG
CCCTTCCAAGCCAAAGGCAACGGCGCTCGCCTTTACAAGACCATCTTCGATTACTACCAGCAGCACTCCGCGACG
CAGGAGCTCACAGTCGAGAGTCCCAGCGAAGCATTCGACGACCTCCGAGACGTCTGCGATCTGGCTTTTCTTCGC
TCCGTGCCCGAGTTCAACGCGCTCAGCCTCGACGCCTCAGCAAAGTTGCCGGAATCCGGCAAACTGCCTCCTCTG
GTCGTCGGCAGTGATAAGCTCGAGCTCATAAGGAAAAAAACCAAGATTGCGCCTCGCCAGTTCGGTCGAGTCCTT
GAGATGCATCTCATGTCCCAGCTGCCGGACTCGGTTCAGCCGACATTGGAATACGACGAAAACCTTCCAACCCCT
ACCAAAGAAGACAAGCATCTGGAGAAGATCTGGAAGCTGTTTGTCCAGCAGAGGCTCTTTCGTCACAACGCAGAG
CTCATATCACAAATTGAACCGTCGCAGCGCATCGAGAAGCTACGCGAGACGTTGGGCAGCGTCGAGCTCGAATAC
GCCCGGTTGCTGGCTGCCTACGAGCGAGCGTCGAAACCACGACTGCAACCCACTGGCAAGCGTCCGCTGGATGCC
GAACCAGAGGCACCCAACAAAAAGGCGAGAGTTGAGGGCCCACAAGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail