Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04513
Gene name
Locationscaffold_04:3455058..3457168
Strand-
Gene length (bp)2110
Transcript length (bp)2052
Coding sequence length (bp)2052
Protein length (aa) 684

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04791 LMBR1 LMBR1-like membrane protein 2.9E-103 14 509

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 43 65 22
3 89 111 22
4 132 154 22
5 164 186 22
6 352 374 22
7 397 419 22
8 440 462 22
9 492 509 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 33.49 18.84 48.15
Alive In ants, during behavior modification 110.15 55.56 164.74
Dead In ants, recently dead 62.27 35.03 89.52

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000454 yes
Dead Fungus 0.000851 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04513
MPHATSAATPVGSIVFCLLALLVISLGVLLMLRHYLPLRSTPAFYLVPIFFALWLPSIVVILVPVDLASSAATDD
DATKGIWLPQRVILVSWRITYWLTFALTWFILPILAEYSDAGYRDSDDKLRYSLRQNAQFYAIFVLAGLAGFIYT
AVVYKLDFASLKAFVMAASYCWVLVFAIYLMGHGLVSIPRRLIRGASISGSLRRLQAMAPKVHDQMEDSLVALEE
VEEEVLEVRRRKVSSCVEFQDWIEELASLIPNQPPSTTMEPASRTSVPVVMTQKYLADLTRRLTRGRHARSRRLD
EWNCMKQEASRMQAILNSAASKSLDFGGSSKSILTPYTRYLYYYHVAPRMRLVLGGLLAVASVCILWSELIRFAF
PKLSIIRLSVIHHWVGGKAQVGFAGQTISCLYICYMCAAALVSVTEVKAWRGRALVKRNTAYESAFWYSTQVAKL
CIPLSYNYVTFLTPDVYKKTTFYRFLGEQIESTAPGRWFDDLFPIILLFPVVATLFGLYGRAKRLLFGIDMVDDD
DGDDPFGYGTYSWREGQRLLEQDVEGNEASRRQQDATMRLAAALGSRSAPGSVSAAGTTTGGGSFGGPRSTSPKP
RLPPRQRFSETEPEDDNILQILGHRMRNTIDTMEPPRWLQEIGEGIKKTDLFPGDGRVGDVDFRRWFGGGGGGGG
GGGGRIRL*
Coding >Ophcf2|04513
ATGCCGCACGCCACCAGCGCCGCGACGCCTGTCGGCTCCATCGTCTTTTGTCTCTTGGCGCTGCTCGTCATCTCC
CTCGGGGTCCTGCTGATGCTACGGCATTACCTTCCGCTCCGCTCGACACCGGCTTTCTATCTTGTTCCCATATTC
TTTGCCTTGTGGCTTCCATCGATCGTCGTTATCCTCGTTCCTGTGGACCTCGCGTCGAGCGCGGCAACCGACGAT
GATGCTACAAAAGGCATATGGCTTCCTCAACGTGTTATCCTAGTGTCATGGAGGATTACGTACTGGCTGACGTTT
GCCCTGACCTGGTTTATTCTTCCCATTCTTGCCGAGTACTCCGATGCTGGTTATCGCGATTCCGACGACAAGCTG
AGATACTCGCTGCGACAGAATGCCCAGTTCTACGCAATCTTCGTCCTCGCGGGGCTCGCCGGCTTCATCTACACG
GCAGTCGTCTACAAGCTCGACTTTGCGTCGCTCAAAGCCTTTGTCATGGCCGCCTCTTACTGCTGGGTCCTCGTC
TTTGCCATCTACCTCATGGGCCACGGGCTGGTATCGATCCCGAGACGCCTGATCCGCGGCGCCAGTATCAGCGGC
AGCTTACGACGATTACAAGCCATGGCACCCAAGGTTCACGATCAGATGGAAGACTCGCTCGTCGCGCTGGAGGAG
GTAGAGGAGGAGGTCCTCGAGGTCCGCCGGCGCAAGGTCAGCAGCTGTGTGGAGTTTCAAGACTGGATAGAGGAG
CTGGCCAGTCTCATCCCCAACCAACCGCCATCGACGACCATGGAGCCCGCAAGCCGAACCTCGGTTCCCGTCGTC
ATGACGCAGAAATATCTGGCTGATCTCACAAGACGACTCACTCGCGGGCGTCACGCGAGGTCTCGACGCCTAGAC
GAGTGGAACTGCATGAAACAAGAGGCATCAAGAATGCAAGCCATCCTCAACTCGGCGGCCTCCAAGAGCCTCGAT
TTTGGCGGTTCGTCCAAGAGCATACTGACGCCCTACACCCGTTACCTGTACTATTATCACGTCGCTCCTCGCATG
CGTCTGGTCCTAGGCGGTCTGCTGGCGGTGGCCTCGGTCTGCATCCTGTGGTCAGAGCTGATCAGATTTGCGTTT
CCGAAGCTATCCATCATCCGCCTCAGCGTCATCCACCACTGGGTAGGCGGCAAGGCACAGGTAGGATTCGCGGGC
CAGACGATATCGTGTCTATACATCTGCTACATGTGTGCCGCCGCGCTTGTGTCGGTAACCGAGGTCAAGGCCTGG
CGAGGACGGGCTCTGGTGAAGCGGAATACGGCATACGAGTCGGCGTTTTGGTACTCGACTCAAGTGGCCAAGCTC
TGCATCCCTCTCTCTTACAACTACGTGACGTTCCTCACGCCCGACGTCTACAAGAAGACGACGTTTTACCGATTC
CTCGGCGAGCAGATTGAGTCGACGGCACCGGGTCGCTGGTTCGACGACTTGTTTCCTATCATTCTCCTTTTCCCT
GTGGTGGCGACGCTATTCGGGCTGTACGGCAGGGCCAAACGTCTCTTGTTCGGCATCGACATGGTTGACGACGAT
GACGGTGATGATCCGTTCGGCTACGGCACTTACTCCTGGCGTGAGGGCCAGCGACTGCTAGAGCAAGACGTCGAG
GGCAACGAGGCGTCCCGACGACAACAAGACGCGACGATGAGGCTCGCCGCAGCCCTCGGCAGCCGATCAGCGCCG
GGCTCCGTGTCCGCAGCGGGGACGACAACCGGAGGCGGCAGCTTCGGAGGTCCCCGATCGACGTCGCCGAAGCCG
AGGCTGCCACCACGACAGCGATTCTCGGAGACGGAGCCCGAGGATGATAATATCCTGCAGATTCTCGGGCATCGG
ATGAGGAACACGATTGATACGATGGAGCCGCCGCGGTGGTTGCAGGAGATTGGCGAGGGGATCAAGAAAACGGAT
CTGTTTCCTGGGGATGGACGCGTTGGTGACGTTGATTTCCGGCGCTGGTTTGGGGGGGGAGGCGGAGGCGGAGGC
GGAGGCGGAGGACGGATCCGTCTGTAG
Transcript >Ophcf2|04513
ATGCCGCACGCCACCAGCGCCGCGACGCCTGTCGGCTCCATCGTCTTTTGTCTCTTGGCGCTGCTCGTCATCTCC
CTCGGGGTCCTGCTGATGCTACGGCATTACCTTCCGCTCCGCTCGACACCGGCTTTCTATCTTGTTCCCATATTC
TTTGCCTTGTGGCTTCCATCGATCGTCGTTATCCTCGTTCCTGTGGACCTCGCGTCGAGCGCGGCAACCGACGAT
GATGCTACAAAAGGCATATGGCTTCCTCAACGTGTTATCCTAGTGTCATGGAGGATTACGTACTGGCTGACGTTT
GCCCTGACCTGGTTTATTCTTCCCATTCTTGCCGAGTACTCCGATGCTGGTTATCGCGATTCCGACGACAAGCTG
AGATACTCGCTGCGACAGAATGCCCAGTTCTACGCAATCTTCGTCCTCGCGGGGCTCGCCGGCTTCATCTACACG
GCAGTCGTCTACAAGCTCGACTTTGCGTCGCTCAAAGCCTTTGTCATGGCCGCCTCTTACTGCTGGGTCCTCGTC
TTTGCCATCTACCTCATGGGCCACGGGCTGGTATCGATCCCGAGACGCCTGATCCGCGGCGCCAGTATCAGCGGC
AGCTTACGACGATTACAAGCCATGGCACCCAAGGTTCACGATCAGATGGAAGACTCGCTCGTCGCGCTGGAGGAG
GTAGAGGAGGAGGTCCTCGAGGTCCGCCGGCGCAAGGTCAGCAGCTGTGTGGAGTTTCAAGACTGGATAGAGGAG
CTGGCCAGTCTCATCCCCAACCAACCGCCATCGACGACCATGGAGCCCGCAAGCCGAACCTCGGTTCCCGTCGTC
ATGACGCAGAAATATCTGGCTGATCTCACAAGACGACTCACTCGCGGGCGTCACGCGAGGTCTCGACGCCTAGAC
GAGTGGAACTGCATGAAACAAGAGGCATCAAGAATGCAAGCCATCCTCAACTCGGCGGCCTCCAAGAGCCTCGAT
TTTGGCGGTTCGTCCAAGAGCATACTGACGCCCTACACCCGTTACCTGTACTATTATCACGTCGCTCCTCGCATG
CGTCTGGTCCTAGGCGGTCTGCTGGCGGTGGCCTCGGTCTGCATCCTGTGGTCAGAGCTGATCAGATTTGCGTTT
CCGAAGCTATCCATCATCCGCCTCAGCGTCATCCACCACTGGGTAGGCGGCAAGGCACAGGTAGGATTCGCGGGC
CAGACGATATCGTGTCTATACATCTGCTACATGTGTGCCGCCGCGCTTGTGTCGGTAACCGAGGTCAAGGCCTGG
CGAGGACGGGCTCTGGTGAAGCGGAATACGGCATACGAGTCGGCGTTTTGGTACTCGACTCAAGTGGCCAAGCTC
TGCATCCCTCTCTCTTACAACTACGTGACGTTCCTCACGCCCGACGTCTACAAGAAGACGACGTTTTACCGATTC
CTCGGCGAGCAGATTGAGTCGACGGCACCGGGTCGCTGGTTCGACGACTTGTTTCCTATCATTCTCCTTTTCCCT
GTGGTGGCGACGCTATTCGGGCTGTACGGCAGGGCCAAACGTCTCTTGTTCGGCATCGACATGGTTGACGACGAT
GACGGTGATGATCCGTTCGGCTACGGCACTTACTCCTGGCGTGAGGGCCAGCGACTGCTAGAGCAAGACGTCGAG
GGCAACGAGGCGTCCCGACGACAACAAGACGCGACGATGAGGCTCGCCGCAGCCCTCGGCAGCCGATCAGCGCCG
GGCTCCGTGTCCGCAGCGGGGACGACAACCGGAGGCGGCAGCTTCGGAGGTCCCCGATCGACGTCGCCGAAGCCG
AGGCTGCCACCACGACAGCGATTCTCGGAGACGGAGCCCGAGGATGATAATATCCTGCAGATTCTCGGGCATCGG
ATGAGGAACACGATTGATACGATGGAGCCGCCGCGGTGGTTGCAGGAGATTGGCGAGGGGATCAAGAAAACGGAT
CTGTTTCCTGGGGATGGACGCGTTGGTGACGTTGATTTCCGGCGCTGGTTTGGGGGGGGAGGCGGAGGCGGAGGC
GGAGGCGGAGGACGGATCCGTCTGTAG
Gene >Ophcf2|04513
ATGCCGCACGCCACCAGCGCCGCGACGCCTGTCGGCTCCATCGTCTTTTGTCTCTTGGCGCTGCTCGTCATCTCC
CTCGGGGTCCTGCTGATGCTACGGCATTACCTTCCGCTCCGCTCGACACCGGCTTTCTATCTTGTTCCCATATTC
TTTGCCTTGTGGCTTCCATCGATCGTCGTTATCCTCGTTCCTGTGGACCTCGCGTCGAGCGCGGCAACCGACGAT
GATGCTACAAAAGGCATATGGCTTCCTCAACGTGTTATCCTAGTGTCATGGAGGATTACGTACTGGCTGACGTTT
GCCCTGACCTGGTATGCCTTGCCAAAGCTTTCAAAGGGCTTCCGTTGATTATGCTAATCTGGGCTTCAGGTTTAT
TCTTCCCATTCTTGCCGAGTACTCCGATGCTGGTTATCGCGATTCCGACGACAAGCTGAGATACTCGCTGCGACA
GAATGCCCAGTTCTACGCAATCTTCGTCCTCGCGGGGCTCGCCGGCTTCATCTACACGGCAGTCGTCTACAAGCT
CGACTTTGCGTCGCTCAAAGCCTTTGTCATGGCCGCCTCTTACTGCTGGGTCCTCGTCTTTGCCATCTACCTCAT
GGGCCACGGGCTGGTATCGATCCCGAGACGCCTGATCCGCGGCGCCAGTATCAGCGGCAGCTTACGACGATTACA
AGCCATGGCACCCAAGGTTCACGATCAGATGGAAGACTCGCTCGTCGCGCTGGAGGAGGTAGAGGAGGAGGTCCT
CGAGGTCCGCCGGCGCAAGGTCAGCAGCTGTGTGGAGTTTCAAGACTGGATAGAGGAGCTGGCCAGTCTCATCCC
CAACCAACCGCCATCGACGACCATGGAGCCCGCAAGCCGAACCTCGGTTCCCGTCGTCATGACGCAGAAATATCT
GGCTGATCTCACAAGACGACTCACTCGCGGGCGTCACGCGAGGTCTCGACGCCTAGACGAGTGGAACTGCATGAA
ACAAGAGGCATCAAGAATGCAAGCCATCCTCAACTCGGCGGCCTCCAAGAGCCTCGATTTTGGCGGTTCGTCCAA
GAGCATACTGACGCCCTACACCCGTTACCTGTACTATTATCACGTCGCTCCTCGCATGCGTCTGGTCCTAGGCGG
TCTGCTGGCGGTGGCCTCGGTCTGCATCCTGTGGTCAGAGCTGATCAGATTTGCGTTTCCGAAGCTATCCATCAT
CCGCCTCAGCGTCATCCACCACTGGGTAGGCGGCAAGGCACAGGTAGGATTCGCGGGCCAGACGATATCGTGTCT
ATACATCTGCTACATGTGTGCCGCCGCGCTTGTGTCGGTAACCGAGGTCAAGGCCTGGCGAGGACGGGCTCTGGT
GAAGCGGAATACGGCATACGAGTCGGCGTTTTGGTACTCGACTCAAGTGGCCAAGCTCTGCATCCCTCTCTCTTA
CAACTACGTGACGTTCCTCACGCCCGACGTCTACAAGAAGACGACGTTTTACCGATTCCTCGGCGAGCAGATTGA
GTCGACGGCACCGGGTCGCTGGTTCGACGACTTGTTTCCTATCATTCTCCTTTTCCCTGTGGTGGCGACGCTATT
CGGGCTGTACGGCAGGGCCAAACGTCTCTTGTTCGGCATCGACATGGTTGACGACGATGACGGTGATGATCCGTT
CGGCTACGGCACTTACTCCTGGCGTGAGGGCCAGCGACTGCTAGAGCAAGACGTCGAGGGCAACGAGGCGTCCCG
ACGACAACAAGACGCGACGATGAGGCTCGCCGCAGCCCTCGGCAGCCGATCAGCGCCGGGCTCCGTGTCCGCAGC
GGGGACGACAACCGGAGGCGGCAGCTTCGGAGGTCCCCGATCGACGTCGCCGAAGCCGAGGCTGCCACCACGACA
GCGATTCTCGGAGACGGAGCCCGAGGATGATAATATCCTGCAGATTCTCGGGCATCGGATGAGGAACACGATTGA
TACGATGGAGCCGCCGCGGTGGTTGCAGGAGATTGGCGAGGGGATCAAGAAAACGGATCTGTTTCCTGGGGATGG
ACGCGTTGGTGACGTTGATTTCCGGCGCTGGTTTGGGGGGGGAGGCGGAGGCGGAGGCGGAGGCGGAGGACGGAT
CCGTCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail