Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04513
Gene name
Locationscaffold_04:3455058..3457168
Strand-
Gene length (bp)2110
Transcript length (bp)2052
Coding sequence length (bp)2052
Protein length (aa) 684

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04791 LMBR1 LMBR1-like membrane protein 2.9E-103 14 509

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 43 65 22
3 89 111 22
4 132 154 22
5 164 186 22
6 352 374 22
7 397 419 22
8 440 462 22
9 492 509 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04513
MPHATSAATPVGSIVFCLLALLVISLGVLLMLRHYLPLRSTPAFYLVPIFFALWLPSIVVILVPVDLASSAATDD
DATKGIWLPQRVILVSWRITYWLTFALTWFILPILAEYSDAGYRDSDDKLRYSLRQNAQFYAIFVLAGLAGFIYT
AVVYKLDFASLKAFVMAASYCWVLVFAIYLMGHGLVSIPRRLIRGASISGSLRRLQAMAPKVHDQMEDSLVALEE
VEEEVLEVRRRKVSSCVEFQDWIEELASLIPNQPPSTTMEPASRTSVPVVMTQKYLADLTRRLTRGRHARSRRLD
EWNCMKQEASRMQAILNSAASKSLDFGGSSKSILTPYTRYLYYYHVAPRMRLVLGGLLAVASVCILWSELIRFAF
PKLSIIRLSVIHHWVGGKAQVGFAGQTISCLYICYMCAAALVSVTEVKAWRGRALVKRNTAYESAFWYSTQVAKL
CIPLSYNYVTFLTPDVYKKTTFYRFLGEQIESTAPGRWFDDLFPIILLFPVVATLFGLYGRAKRLLFGIDMVDDD
DGDDPFGYGTYSWREGQRLLEQDVEGNEASRRQQDATMRLAAALGSRSAPGSVSAAGTTTGGGSFGGPRSTSPKP
RLPPRQRFSETEPEDDNILQILGHRMRNTIDTMEPPRWLQEIGEGIKKTDLFPGDGRVGDVDFRRWFGGGGGGGG
GGGGRIRL*
Coding >Ophcf2|04513
ATGCCGCACGCCACCAGCGCCGCGACGCCTGTCGGCTCCATCGTCTTTTGTCTCTTGGCGCTGCTCGTCATCTCC
CTCGGGGTCCTGCTGATGCTACGGCATTACCTTCCGCTCCGCTCGACACCGGCTTTCTATCTTGTTCCCATATTC
TTTGCCTTGTGGCTTCCATCGATCGTCGTTATCCTCGTTCCTGTGGACCTCGCGTCGAGCGCGGCAACCGACGAT
GATGCTACAAAAGGCATATGGCTTCCTCAACGTGTTATCCTAGTGTCATGGAGGATTACGTACTGGCTGACGTTT
GCCCTGACCTGGTTTATTCTTCCCATTCTTGCCGAGTACTCCGATGCTGGTTATCGCGATTCCGACGACAAGCTG
AGATACTCGCTGCGACAGAATGCCCAGTTCTACGCAATCTTCGTCCTCGCGGGGCTCGCCGGCTTCATCTACACG
GCAGTCGTCTACAAGCTCGACTTTGCGTCGCTCAAAGCCTTTGTCATGGCCGCCTCTTACTGCTGGGTCCTCGTC
TTTGCCATCTACCTCATGGGCCACGGGCTGGTATCGATCCCGAGACGCCTGATCCGCGGCGCCAGTATCAGCGGC
AGCTTACGACGATTACAAGCCATGGCACCCAAGGTTCACGATCAGATGGAAGACTCGCTCGTCGCGCTGGAGGAG
GTAGAGGAGGAGGTCCTCGAGGTCCGCCGGCGCAAGGTCAGCAGCTGTGTGGAGTTTCAAGACTGGATAGAGGAG
CTGGCCAGTCTCATCCCCAACCAACCGCCATCGACGACCATGGAGCCCGCAAGCCGAACCTCGGTTCCCGTCGTC
ATGACGCAGAAATATCTGGCTGATCTCACAAGACGACTCACTCGCGGGCGTCACGCGAGGTCTCGACGCCTAGAC
GAGTGGAACTGCATGAAACAAGAGGCATCAAGAATGCAAGCCATCCTCAACTCGGCGGCCTCCAAGAGCCTCGAT
TTTGGCGGTTCGTCCAAGAGCATACTGACGCCCTACACCCGTTACCTGTACTATTATCACGTCGCTCCTCGCATG
CGTCTGGTCCTAGGCGGTCTGCTGGCGGTGGCCTCGGTCTGCATCCTGTGGTCAGAGCTGATCAGATTTGCGTTT
CCGAAGCTATCCATCATCCGCCTCAGCGTCATCCACCACTGGGTAGGCGGCAAGGCACAGGTAGGATTCGCGGGC
CAGACGATATCGTGTCTATACATCTGCTACATGTGTGCCGCCGCGCTTGTGTCGGTAACCGAGGTCAAGGCCTGG
CGAGGACGGGCTCTGGTGAAGCGGAATACGGCATACGAGTCGGCGTTTTGGTACTCGACTCAAGTGGCCAAGCTC
TGCATCCCTCTCTCTTACAACTACGTGACGTTCCTCACGCCCGACGTCTACAAGAAGACGACGTTTTACCGATTC
CTCGGCGAGCAGATTGAGTCGACGGCACCGGGTCGCTGGTTCGACGACTTGTTTCCTATCATTCTCCTTTTCCCT
GTGGTGGCGACGCTATTCGGGCTGTACGGCAGGGCCAAACGTCTCTTGTTCGGCATCGACATGGTTGACGACGAT
GACGGTGATGATCCGTTCGGCTACGGCACTTACTCCTGGCGTGAGGGCCAGCGACTGCTAGAGCAAGACGTCGAG
GGCAACGAGGCGTCCCGACGACAACAAGACGCGACGATGAGGCTCGCCGCAGCCCTCGGCAGCCGATCAGCGCCG
GGCTCCGTGTCCGCAGCGGGGACGACAACCGGAGGCGGCAGCTTCGGAGGTCCCCGATCGACGTCGCCGAAGCCG
AGGCTGCCACCACGACAGCGATTCTCGGAGACGGAGCCCGAGGATGATAATATCCTGCAGATTCTCGGGCATCGG
ATGAGGAACACGATTGATACGATGGAGCCGCCGCGGTGGTTGCAGGAGATTGGCGAGGGGATCAAGAAAACGGAT
CTGTTTCCTGGGGATGGACGCGTTGGTGACGTTGATTTCCGGCGCTGGTTTGGGGGGGGAGGCGGAGGCGGAGGC
GGAGGCGGAGGACGGATCCGTCTGTAG
Transcript >Ophcf2|04513
ATGCCGCACGCCACCAGCGCCGCGACGCCTGTCGGCTCCATCGTCTTTTGTCTCTTGGCGCTGCTCGTCATCTCC
CTCGGGGTCCTGCTGATGCTACGGCATTACCTTCCGCTCCGCTCGACACCGGCTTTCTATCTTGTTCCCATATTC
TTTGCCTTGTGGCTTCCATCGATCGTCGTTATCCTCGTTCCTGTGGACCTCGCGTCGAGCGCGGCAACCGACGAT
GATGCTACAAAAGGCATATGGCTTCCTCAACGTGTTATCCTAGTGTCATGGAGGATTACGTACTGGCTGACGTTT
GCCCTGACCTGGTTTATTCTTCCCATTCTTGCCGAGTACTCCGATGCTGGTTATCGCGATTCCGACGACAAGCTG
AGATACTCGCTGCGACAGAATGCCCAGTTCTACGCAATCTTCGTCCTCGCGGGGCTCGCCGGCTTCATCTACACG
GCAGTCGTCTACAAGCTCGACTTTGCGTCGCTCAAAGCCTTTGTCATGGCCGCCTCTTACTGCTGGGTCCTCGTC
TTTGCCATCTACCTCATGGGCCACGGGCTGGTATCGATCCCGAGACGCCTGATCCGCGGCGCCAGTATCAGCGGC
AGCTTACGACGATTACAAGCCATGGCACCCAAGGTTCACGATCAGATGGAAGACTCGCTCGTCGCGCTGGAGGAG
GTAGAGGAGGAGGTCCTCGAGGTCCGCCGGCGCAAGGTCAGCAGCTGTGTGGAGTTTCAAGACTGGATAGAGGAG
CTGGCCAGTCTCATCCCCAACCAACCGCCATCGACGACCATGGAGCCCGCAAGCCGAACCTCGGTTCCCGTCGTC
ATGACGCAGAAATATCTGGCTGATCTCACAAGACGACTCACTCGCGGGCGTCACGCGAGGTCTCGACGCCTAGAC
GAGTGGAACTGCATGAAACAAGAGGCATCAAGAATGCAAGCCATCCTCAACTCGGCGGCCTCCAAGAGCCTCGAT
TTTGGCGGTTCGTCCAAGAGCATACTGACGCCCTACACCCGTTACCTGTACTATTATCACGTCGCTCCTCGCATG
CGTCTGGTCCTAGGCGGTCTGCTGGCGGTGGCCTCGGTCTGCATCCTGTGGTCAGAGCTGATCAGATTTGCGTTT
CCGAAGCTATCCATCATCCGCCTCAGCGTCATCCACCACTGGGTAGGCGGCAAGGCACAGGTAGGATTCGCGGGC
CAGACGATATCGTGTCTATACATCTGCTACATGTGTGCCGCCGCGCTTGTGTCGGTAACCGAGGTCAAGGCCTGG
CGAGGACGGGCTCTGGTGAAGCGGAATACGGCATACGAGTCGGCGTTTTGGTACTCGACTCAAGTGGCCAAGCTC
TGCATCCCTCTCTCTTACAACTACGTGACGTTCCTCACGCCCGACGTCTACAAGAAGACGACGTTTTACCGATTC
CTCGGCGAGCAGATTGAGTCGACGGCACCGGGTCGCTGGTTCGACGACTTGTTTCCTATCATTCTCCTTTTCCCT
GTGGTGGCGACGCTATTCGGGCTGTACGGCAGGGCCAAACGTCTCTTGTTCGGCATCGACATGGTTGACGACGAT
GACGGTGATGATCCGTTCGGCTACGGCACTTACTCCTGGCGTGAGGGCCAGCGACTGCTAGAGCAAGACGTCGAG
GGCAACGAGGCGTCCCGACGACAACAAGACGCGACGATGAGGCTCGCCGCAGCCCTCGGCAGCCGATCAGCGCCG
GGCTCCGTGTCCGCAGCGGGGACGACAACCGGAGGCGGCAGCTTCGGAGGTCCCCGATCGACGTCGCCGAAGCCG
AGGCTGCCACCACGACAGCGATTCTCGGAGACGGAGCCCGAGGATGATAATATCCTGCAGATTCTCGGGCATCGG
ATGAGGAACACGATTGATACGATGGAGCCGCCGCGGTGGTTGCAGGAGATTGGCGAGGGGATCAAGAAAACGGAT
CTGTTTCCTGGGGATGGACGCGTTGGTGACGTTGATTTCCGGCGCTGGTTTGGGGGGGGAGGCGGAGGCGGAGGC
GGAGGCGGAGGACGGATCCGTCTGTAG
Gene >Ophcf2|04513
ATGCCGCACGCCACCAGCGCCGCGACGCCTGTCGGCTCCATCGTCTTTTGTCTCTTGGCGCTGCTCGTCATCTCC
CTCGGGGTCCTGCTGATGCTACGGCATTACCTTCCGCTCCGCTCGACACCGGCTTTCTATCTTGTTCCCATATTC
TTTGCCTTGTGGCTTCCATCGATCGTCGTTATCCTCGTTCCTGTGGACCTCGCGTCGAGCGCGGCAACCGACGAT
GATGCTACAAAAGGCATATGGCTTCCTCAACGTGTTATCCTAGTGTCATGGAGGATTACGTACTGGCTGACGTTT
GCCCTGACCTGGTATGCCTTGCCAAAGCTTTCAAAGGGCTTCCGTTGATTATGCTAATCTGGGCTTCAGGTTTAT
TCTTCCCATTCTTGCCGAGTACTCCGATGCTGGTTATCGCGATTCCGACGACAAGCTGAGATACTCGCTGCGACA
GAATGCCCAGTTCTACGCAATCTTCGTCCTCGCGGGGCTCGCCGGCTTCATCTACACGGCAGTCGTCTACAAGCT
CGACTTTGCGTCGCTCAAAGCCTTTGTCATGGCCGCCTCTTACTGCTGGGTCCTCGTCTTTGCCATCTACCTCAT
GGGCCACGGGCTGGTATCGATCCCGAGACGCCTGATCCGCGGCGCCAGTATCAGCGGCAGCTTACGACGATTACA
AGCCATGGCACCCAAGGTTCACGATCAGATGGAAGACTCGCTCGTCGCGCTGGAGGAGGTAGAGGAGGAGGTCCT
CGAGGTCCGCCGGCGCAAGGTCAGCAGCTGTGTGGAGTTTCAAGACTGGATAGAGGAGCTGGCCAGTCTCATCCC
CAACCAACCGCCATCGACGACCATGGAGCCCGCAAGCCGAACCTCGGTTCCCGTCGTCATGACGCAGAAATATCT
GGCTGATCTCACAAGACGACTCACTCGCGGGCGTCACGCGAGGTCTCGACGCCTAGACGAGTGGAACTGCATGAA
ACAAGAGGCATCAAGAATGCAAGCCATCCTCAACTCGGCGGCCTCCAAGAGCCTCGATTTTGGCGGTTCGTCCAA
GAGCATACTGACGCCCTACACCCGTTACCTGTACTATTATCACGTCGCTCCTCGCATGCGTCTGGTCCTAGGCGG
TCTGCTGGCGGTGGCCTCGGTCTGCATCCTGTGGTCAGAGCTGATCAGATTTGCGTTTCCGAAGCTATCCATCAT
CCGCCTCAGCGTCATCCACCACTGGGTAGGCGGCAAGGCACAGGTAGGATTCGCGGGCCAGACGATATCGTGTCT
ATACATCTGCTACATGTGTGCCGCCGCGCTTGTGTCGGTAACCGAGGTCAAGGCCTGGCGAGGACGGGCTCTGGT
GAAGCGGAATACGGCATACGAGTCGGCGTTTTGGTACTCGACTCAAGTGGCCAAGCTCTGCATCCCTCTCTCTTA
CAACTACGTGACGTTCCTCACGCCCGACGTCTACAAGAAGACGACGTTTTACCGATTCCTCGGCGAGCAGATTGA
GTCGACGGCACCGGGTCGCTGGTTCGACGACTTGTTTCCTATCATTCTCCTTTTCCCTGTGGTGGCGACGCTATT
CGGGCTGTACGGCAGGGCCAAACGTCTCTTGTTCGGCATCGACATGGTTGACGACGATGACGGTGATGATCCGTT
CGGCTACGGCACTTACTCCTGGCGTGAGGGCCAGCGACTGCTAGAGCAAGACGTCGAGGGCAACGAGGCGTCCCG
ACGACAACAAGACGCGACGATGAGGCTCGCCGCAGCCCTCGGCAGCCGATCAGCGCCGGGCTCCGTGTCCGCAGC
GGGGACGACAACCGGAGGCGGCAGCTTCGGAGGTCCCCGATCGACGTCGCCGAAGCCGAGGCTGCCACCACGACA
GCGATTCTCGGAGACGGAGCCCGAGGATGATAATATCCTGCAGATTCTCGGGCATCGGATGAGGAACACGATTGA
TACGATGGAGCCGCCGCGGTGGTTGCAGGAGATTGGCGAGGGGATCAAGAAAACGGATCTGTTTCCTGGGGATGG
ACGCGTTGGTGACGTTGATTTCCGGCGCTGGTTTGGGGGGGGAGGCGGAGGCGGAGGCGGAGGCGGAGGACGGAT
CCGTCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail