Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04509
Gene name
Locationscaffold_04:3446740..3447565
Strand+
Gene length (bp)825
Transcript length (bp)825
Coding sequence length (bp)825
Protein length (aa) 275

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.3684 0.5426 0.4668 0.0267 0.4521 0.0939 0.2184 0.1528 0.1417 0.0563

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup11
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1456
Ophiocordyceps camponoti-floridani Ophcf2|04509 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05945
Ophiocordyceps camponoti-floridani Ophcf2|05210
Ophiocordyceps camponoti-floridani Ophcf2|04876
Ophiocordyceps camponoti-floridani Ophcf2|03559
Ophiocordyceps camponoti-floridani Ophcf2|02946
Ophiocordyceps camponoti-floridani Ophcf2|02940
Ophiocordyceps camponoti-floridani Ophcf2|02393
Ophiocordyceps camponoti-floridani Ophcf2|02162
Ophiocordyceps camponoti-floridani Ophcf2|01419
Ophiocordyceps camponoti-floridani Ophcf2|00877
Ophiocordyceps camponoti-floridani Ophcf2|00026
Ophiocordyceps camponoti-floridani Ophcf2|02640
Ophiocordyceps camponoti-rufipedis Ophun1|7018
Ophiocordyceps camponoti-rufipedis Ophun1|5875
Ophiocordyceps camponoti-rufipedis Ophun1|61
Ophiocordyceps camponoti-rufipedis Ophun1|7079
Ophiocordyceps camponoti-rufipedis Ophun1|2808
Ophiocordyceps camponoti-rufipedis Ophun1|7149
Ophiocordyceps camponoti-rufipedis Ophun1|7480
Ophiocordyceps camponoti-rufipedis Ophun1|5641
Ophiocordyceps camponoti-rufipedis Ophun1|7148
Ophiocordyceps camponoti-rufipedis Ophun1|5297
Ophiocordyceps camponoti-rufipedis Ophun1|839
Ophiocordyceps camponoti-rufipedis Ophun1|5181
Ophiocordyceps camponoti-rufipedis Ophun1|5180
Ophiocordyceps camponoti-rufipedis Ophun1|5123
Ophiocordyceps camponoti-rufipedis Ophun1|5085
Ophiocordyceps camponoti-rufipedis Ophun1|4013
Ophiocordyceps camponoti-rufipedis Ophun1|2837
Ophiocordyceps camponoti-rufipedis Ophun1|7483
Ophiocordyceps camponoti-rufipedis Ophun1|1461
Ophiocordyceps camponoti-rufipedis Ophun1|5183
Ophiocordyceps kimflemingae Ophio5|2713
Ophiocordyceps subramaniannii Hirsu2|2752

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04509
MGIRVVDLPFNESGWHFQSVQEELLSTDRDLHDTVVALRPHGRFIRRITAIDADENLQSLPSRGGKYSFEPNPTG
LLDKVVARWQAPTSPCPGEVAIQVHAASINSKEVMNISEKSVTGVLSDQNLSLEVAGKVIDMGEDVSNVQLDANV
MARVAPGVSGYATTDSRFVSPIPGNLTMAQAASIPVDYVTAYYALVHVGRPTRRDSVLVHAAAGSVGAVAIQLAK
LYGARIFATADNSERWEWFVQQSRVFKRFLTQYLHPFTTTSRAPLEIMV*
Coding >Ophcf2|04509
ATGGGCATTCGTGTCGTTGATCTGCCCTTTAATGAGAGCGGCTGGCATTTTCAATCAGTCCAAGAGGAGCTGCTG
TCGACTGATCGCGACCTCCATGACACTGTTGTCGCATTACGCCCCCATGGACGGTTCATCCGACGCATCACGGCT
ATTGATGCCGACGAGAATCTTCAGAGTCTCCCTTCCCGCGGGGGAAAGTATTCGTTCGAACCAAATCCGACCGGC
TTGTTGGACAAGGTAGTTGCCCGATGGCAAGCTCCCACAAGCCCATGCCCGGGCGAGGTGGCGATTCAAGTCCAC
GCCGCTTCTATCAATTCCAAGGAGGTCATGAACATTAGCGAAAAATCCGTCACCGGAGTACTCTCTGATCAGAAC
CTCAGCCTCGAAGTCGCAGGCAAGGTCATCGATATGGGAGAAGACGTCTCTAACGTCCAGCTCGATGCCAACGTC
ATGGCTCGAGTTGCCCCAGGCGTTTCCGGATACGCCACGACAGACAGCCGATTCGTCAGCCCGATTCCCGGCAAC
CTCACTATGGCTCAAGCGGCGTCCATCCCTGTAGACTATGTCACGGCATACTATGCTCTGGTCCATGTCGGGAGA
CCGACTCGTCGAGACTCTGTTCTTGTTCACGCAGCGGCCGGTAGCGTGGGAGCCGTCGCCATACAACTCGCCAAA
CTGTACGGAGCTCGCATCTTTGCGACGGCTGACAACTCTGAGCGTTGGGAATGGTTCGTTCAGCAGAGCAGGGTG
TTCAAGAGGTTTTTGACTCAATACCTGCATCCTTTCACGACAACATCAAGAGCGCCACTGGAAATCATGGTGTAG
Transcript >Ophcf2|04509
ATGGGCATTCGTGTCGTTGATCTGCCCTTTAATGAGAGCGGCTGGCATTTTCAATCAGTCCAAGAGGAGCTGCTG
TCGACTGATCGCGACCTCCATGACACTGTTGTCGCATTACGCCCCCATGGACGGTTCATCCGACGCATCACGGCT
ATTGATGCCGACGAGAATCTTCAGAGTCTCCCTTCCCGCGGGGGAAAGTATTCGTTCGAACCAAATCCGACCGGC
TTGTTGGACAAGGTAGTTGCCCGATGGCAAGCTCCCACAAGCCCATGCCCGGGCGAGGTGGCGATTCAAGTCCAC
GCCGCTTCTATCAATTCCAAGGAGGTCATGAACATTAGCGAAAAATCCGTCACCGGAGTACTCTCTGATCAGAAC
CTCAGCCTCGAAGTCGCAGGCAAGGTCATCGATATGGGAGAAGACGTCTCTAACGTCCAGCTCGATGCCAACGTC
ATGGCTCGAGTTGCCCCAGGCGTTTCCGGATACGCCACGACAGACAGCCGATTCGTCAGCCCGATTCCCGGCAAC
CTCACTATGGCTCAAGCGGCGTCCATCCCTGTAGACTATGTCACGGCATACTATGCTCTGGTCCATGTCGGGAGA
CCGACTCGTCGAGACTCTGTTCTTGTTCACGCAGCGGCCGGTAGCGTGGGAGCCGTCGCCATACAACTCGCCAAA
CTGTACGGAGCTCGCATCTTTGCGACGGCTGACAACTCTGAGCGTTGGGAATGGTTCGTTCAGCAGAGCAGGGTG
TTCAAGAGGTTTTTGACTCAATACCTGCATCCTTTCACGACAACATCAAGAGCGCCACTGGAAATCATGGTGTAG
Gene >Ophcf2|04509
ATGGGCATTCGTGTCGTTGATCTGCCCTTTAATGAGAGCGGCTGGCATTTTCAATCAGTCCAAGAGGAGCTGCTG
TCGACTGATCGCGACCTCCATGACACTGTTGTCGCATTACGCCCCCATGGACGGTTCATCCGACGCATCACGGCT
ATTGATGCCGACGAGAATCTTCAGAGTCTCCCTTCCCGCGGGGGAAAGTATTCGTTCGAACCAAATCCGACCGGC
TTGTTGGACAAGGTAGTTGCCCGATGGCAAGCTCCCACAAGCCCATGCCCGGGCGAGGTGGCGATTCAAGTCCAC
GCCGCTTCTATCAATTCCAAGGAGGTCATGAACATTAGCGAAAAATCCGTCACCGGAGTACTCTCTGATCAGAAC
CTCAGCCTCGAAGTCGCAGGCAAGGTCATCGATATGGGAGAAGACGTCTCTAACGTCCAGCTCGATGCCAACGTC
ATGGCTCGAGTTGCCCCAGGCGTTTCCGGATACGCCACGACAGACAGCCGATTCGTCAGCCCGATTCCCGGCAAC
CTCACTATGGCTCAAGCGGCGTCCATCCCTGTAGACTATGTCACGGCATACTATGCTCTGGTCCATGTCGGGAGA
CCGACTCGTCGAGACTCTGTTCTTGTTCACGCAGCGGCCGGTAGCGTGGGAGCCGTCGCCATACAACTCGCCAAA
CTGTACGGAGCTCGCATCTTTGCGACGGCTGACAACTCTGAGCGTTGGGAATGGTTCGTTCAGCAGAGCAGGGTG
TTCAAGAGGTTTTTGACTCAATACCTGCATCCTTTCACGACAACATCAAGAGCGCCACTGGAAATCATGGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail