Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04505
Gene name
Locationscaffold_04:3437905..3441890
Strand-
Gene length (bp)3985
Transcript length (bp)3669
Coding sequence length (bp)3669
Protein length (aa) 1223

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10433 MMS1_N Mono-functional DNA-alkylating methyl methanesulfonate N-term 1.7E-138 82 618
PF03178 CPSF_A CPSF A subunit region 1.1E-89 864 1187

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0003676 nucleic acid binding Yes
GO:0005575 cellular_component No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:1901363 heterocyclic compound binding No
GO:0043229 intracellular organelle No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0005488 binding No
GO:0043226 organelle No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.5404 0.5246 0.0175 0.1537 0.0829 0.01 0.2218 0.4402 0.334 0.0057

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2489
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6924
Ophiocordyceps australis map64 (Brazil) OphauB2|781
Ophiocordyceps camponoti-floridani Ophcf2|04505 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5645
Ophiocordyceps kimflemingae Ophio5|5810
Ophiocordyceps subramaniannii Hirsu2|36

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04505
MATTSNQFLYSLTIQPPSHIVHATLGQFGGTREQLIITAAGSQLSLLRPDPIQGKVHTILTHNVFGIIRSLAAFR
VTGSSKDFIIIASDSGRVTIVEYLPDKNRFSRVHMETYGKSGIRRVVPGEYLVCDPKGRAFLVASVEKNKLVYVL
NRIAGATTEDNLAAELTISSPLEAHKPGVLVISMVALDVGYSNPVFAALEVDCSEVDQDATGEALEELQTQLVYY
ELDLGLNYVVRKWSDTVDPTASILFQVPGGSDGPSGVLVCGHESITYMHSNQEALRVAIPRRRGALEDPSRKRTI
VSGIMHKLKGSTGAFFFLLQTEDGDIFRVTMDMIKDQDGKTTGDVKRLLIKYFDTVPVATSFCILKNGFLYVASQ
HSDPGFYQFEKLGDDDDELEFNSDQFPVDHKAPYDPVYFHPRKADNITLFQNVPSMNPLMDCKIANLTGDDAPQI
YTACGSGARSSFRTLKHGLDVTHIVGSQLPGTPSAVWTLKLKRDDEFDAFLVLSFANVSLILSIGETVEQVDDSG
LFTDIPTLAAQLLGDGGLVQVHAKGIRVVRNGRPDDWDAPQHRSIVAAATNAQQVAIALSSGEIIYFEADEEGNL
NEFEDRKGMRGTVTCLSLGDVPNGRLRSSFLAVGCDDCTVRILSLDHGSTLEKKSVQALTAAPTSLAIMSMIDSS
SGGSTLYLHIGLHSGVYLRTVLDEVSGELSDTRQKFLGPKQVGLFQLTVEGKTCVLALSSRPWLGYPDPITNSFT
MAPLNYPELVWGWNFKSPQCKEGLVTIHGQDLSILSIDRLGDAFTQKSIPLTYTPRALVKHPEQPLFYTIESDNN
TLPINIREQLLADPAAVNGDATTLPPNVFGHPKGNRHWASCISVIDPMAEDENARVVQTLHLDQNESAISATIVP
FLAQYGEHFLVVGVGKDVIINPRKFSEASIHVYRLNDNGRELELVHKTPVEDLPYALLAFQGRVLVGIGKVLRAY
DLGIRQLLRKSHAEVAPQQIVSLGTQGNRIIVGDIHQGITFVIFKPATNRLIPFADDAVQRWMTCSTMVDYESVA
GGDKFGNLFLVRCPPKASQEADEDDSGVHLVNARSYIHGCPWRHDLVCHFFTNDIPTNVTKTSLVVGGQDVLLWS
GLMGTIGVLIPLLSREDADFFQSLEQHLRSEDPPLAGRDHLMYRGYYAPVKGVIDGDLCERYNLLTQEKKAMIAG
ELDRSVREIERKISDLRTRSAF*
Coding >Ophcf2|04505
ATGGCTACGACTTCGAACCAGTTCCTTTACTCTTTGACGATCCAGCCTCCCAGTCACATCGTTCACGCGACTCTG
GGCCAGTTTGGTGGCACTCGAGAGCAGCTCATCATCACGGCTGCGGGCTCGCAATTGTCGCTGCTTCGCCCCGAT
CCTATTCAGGGCAAGGTGCACACGATCCTCACTCATAATGTCTTTGGCATCATTCGGTCTCTGGCCGCGTTTCGC
GTCACTGGTAGCAGCAAGGACTTTATCATCATCGCTTCCGATTCCGGTCGCGTGACAATTGTCGAGTACCTACCG
GATAAGAATCGCTTCTCTCGCGTACACATGGAAACTTATGGCAAGTCTGGCATCCGAAGAGTCGTTCCGGGCGAG
TACCTGGTCTGCGATCCCAAAGGTCGAGCCTTTCTCGTCGCCTCTGTGGAAAAGAACAAGCTCGTCTATGTTCTC
AACCGTATCGCGGGGGCTACCACCGAAGATAACCTCGCTGCCGAGCTCACCATATCCTCTCCCCTCGAAGCTCAC
AAGCCCGGCGTTCTCGTCATCTCCATGGTGGCGCTTGACGTGGGATACTCCAACCCTGTCTTCGCTGCTCTCGAG
GTCGACTGCTCTGAAGTCGATCAGGACGCGACTGGAGAAGCACTCGAGGAACTCCAGACCCAGCTCGTGTATTAC
GAGCTCGACCTTGGACTGAATTACGTCGTTCGCAAGTGGTCAGACACTGTTGACCCGACGGCCTCGATCCTTTTC
CAGGTCCCTGGCGGCAGCGATGGCCCCAGTGGCGTCCTCGTCTGTGGGCATGAGAGCATCACCTACATGCACAGC
AATCAAGAGGCCTTGCGCGTCGCCATTCCTCGCCGCAGAGGGGCCCTCGAGGATCCGTCCCGGAAAAGGACCATT
GTCTCTGGCATCATGCACAAACTCAAAGGCAGTACTGGCGCCTTCTTTTTCCTCCTGCAAACCGAGGATGGCGAC
ATCTTCCGAGTCACCATGGACATGATTAAGGATCAGGATGGCAAGACGACGGGAGACGTCAAGCGACTCCTAATC
AAGTACTTTGACACCGTTCCTGTGGCCACCAGCTTCTGCATCCTCAAGAACGGCTTTCTATACGTTGCCAGTCAG
CACAGTGACCCCGGCTTCTATCAGTTCGAGAAGCTCGGCGATGATGACGACGAGCTCGAGTTCAACAGCGACCAA
TTTCCCGTTGATCACAAGGCGCCGTATGACCCCGTCTACTTCCATCCTCGCAAGGCAGACAACATCACACTGTTC
CAGAACGTTCCCTCCATGAACCCGCTCATGGACTGCAAGATCGCCAATCTGACCGGTGACGACGCGCCCCAGATC
TACACGGCCTGTGGCAGCGGAGCACGGAGCTCATTTCGCACGCTGAAGCATGGGCTTGACGTCACGCACATCGTC
GGCTCTCAGCTGCCCGGAACGCCATCGGCTGTGTGGACGCTGAAGCTGAAGCGAGACGACGAGTTTGACGCCTTC
CTGGTCCTCTCATTTGCCAACGTGTCTCTCATCCTTAGTATTGGAGAGACGGTGGAGCAGGTGGACGACTCGGGC
TTATTCACCGACATTCCCACTCTCGCAGCCCAGCTCCTCGGTGACGGCGGCCTGGTTCAAGTCCACGCCAAGGGC
ATCCGAGTCGTCCGCAACGGGCGGCCCGATGACTGGGACGCTCCCCAGCATCGCTCCATCGTCGCGGCCGCCACC
AACGCCCAGCAGGTGGCCATCGCCCTGAGCTCCGGCGAGATTATCTACTTCGAGGCCGACGAAGAGGGTAACCTC
AACGAATTTGAGGATCGAAAGGGCATGCGGGGGACCGTCACTTGCCTGAGCCTGGGTGACGTTCCCAATGGGAGG
CTCCGCAGCTCTTTTCTCGCCGTCGGCTGCGATGATTGCACCGTACGCATCCTCAGTCTGGATCACGGCTCGACG
CTCGAAAAGAAATCGGTTCAGGCCTTGACGGCCGCGCCCACGTCTTTGGCCATTATGAGTATGATCGACTCGTCT
TCGGGCGGCTCCACGCTCTACCTGCACATCGGACTGCATTCGGGCGTCTACCTGCGCACGGTTTTAGACGAGGTG
TCGGGCGAGCTGTCCGATACACGACAAAAGTTCCTGGGGCCCAAGCAGGTCGGGCTCTTCCAGCTCACCGTCGAG
GGCAAGACGTGCGTTCTGGCCCTGAGCTCCCGGCCCTGGCTCGGCTATCCGGATCCCATCACCAACAGCTTCACC
ATGGCGCCTCTGAACTATCCGGAGCTGGTCTGGGGCTGGAACTTTAAGAGCCCGCAGTGCAAGGAGGGACTCGTG
ACGATTCACGGACAAGACCTGAGCATTCTGTCGATTGACAGATTAGGAGACGCCTTCACTCAGAAGTCGATCCCT
CTTACTTACACTCCCAGGGCGCTCGTCAAGCATCCGGAGCAGCCCTTGTTCTACACCATTGAATCCGACAACAAC
ACGCTCCCAATCAACATACGGGAGCAGTTGCTCGCCGATCCCGCCGCGGTGAATGGCGATGCAACGACGCTCCCC
CCCAATGTCTTTGGTCACCCCAAAGGTAACCGTCACTGGGCGTCGTGCATCAGCGTCATCGACCCGATGGCCGAG
GACGAGAATGCCCGAGTGGTGCAGACGCTTCACCTGGACCAGAACGAGTCGGCCATCAGCGCCACCATTGTCCCG
TTCCTCGCCCAATATGGAGAGCATTTCCTGGTTGTCGGCGTCGGCAAAGACGTCATCATCAACCCTCGAAAATTC
TCCGAGGCTTCCATTCACGTCTATCGTCTCAACGACAACGGGCGTGAACTTGAGTTGGTTCACAAAACCCCGGTC
GAAGACTTGCCGTACGCGTTGTTGGCCTTTCAAGGGAGGGTACTCGTCGGAATCGGCAAGGTCTTGCGAGCATAC
GATCTCGGCATACGACAGCTGTTGCGCAAGTCGCATGCCGAGGTGGCGCCACAACAGATTGTGTCGCTCGGCACG
CAGGGGAACCGCATCATCGTCGGTGACATTCATCAGGGCATCACCTTTGTCATCTTCAAGCCTGCGACGAACAGG
CTGATTCCGTTCGCAGACGACGCCGTGCAGCGATGGATGACGTGCTCGACCATGGTCGACTACGAATCCGTCGCT
GGCGGTGACAAGTTTGGGAACCTCTTCCTGGTGCGATGCCCGCCCAAGGCCTCTCAGGAGGCGGACGAGGACGAC
TCGGGCGTTCACTTGGTCAACGCGCGGTCCTACATCCACGGGTGTCCCTGGCGACACGACCTCGTCTGCCACTTT
TTTACCAACGACATCCCCACCAACGTCACCAAGACCAGCCTCGTCGTCGGAGGTCAGGACGTGTTGCTGTGGAGC
GGACTCATGGGGACCATTGGCGTGCTCATCCCCCTCCTCAGCAGAGAGGATGCCGACTTCTTCCAGAGTCTGGAG
CAGCATCTCCGCAGCGAGGACCCGCCGTTGGCTGGCCGAGATCATCTGATGTACCGCGGCTACTATGCTCCGGTC
AAGGGCGTCATCGACGGTGACCTCTGCGAGCGGTACAACCTATTGACTCAGGAGAAGAAGGCCATGATTGCGGGA
GAGCTGGACCGATCTGTTCGGGAGATTGAGAGGAAGATTTCGGATCTCCGGACCCGATCTGCTTTCTAA
Transcript >Ophcf2|04505
ATGGCTACGACTTCGAACCAGTTCCTTTACTCTTTGACGATCCAGCCTCCCAGTCACATCGTTCACGCGACTCTG
GGCCAGTTTGGTGGCACTCGAGAGCAGCTCATCATCACGGCTGCGGGCTCGCAATTGTCGCTGCTTCGCCCCGAT
CCTATTCAGGGCAAGGTGCACACGATCCTCACTCATAATGTCTTTGGCATCATTCGGTCTCTGGCCGCGTTTCGC
GTCACTGGTAGCAGCAAGGACTTTATCATCATCGCTTCCGATTCCGGTCGCGTGACAATTGTCGAGTACCTACCG
GATAAGAATCGCTTCTCTCGCGTACACATGGAAACTTATGGCAAGTCTGGCATCCGAAGAGTCGTTCCGGGCGAG
TACCTGGTCTGCGATCCCAAAGGTCGAGCCTTTCTCGTCGCCTCTGTGGAAAAGAACAAGCTCGTCTATGTTCTC
AACCGTATCGCGGGGGCTACCACCGAAGATAACCTCGCTGCCGAGCTCACCATATCCTCTCCCCTCGAAGCTCAC
AAGCCCGGCGTTCTCGTCATCTCCATGGTGGCGCTTGACGTGGGATACTCCAACCCTGTCTTCGCTGCTCTCGAG
GTCGACTGCTCTGAAGTCGATCAGGACGCGACTGGAGAAGCACTCGAGGAACTCCAGACCCAGCTCGTGTATTAC
GAGCTCGACCTTGGACTGAATTACGTCGTTCGCAAGTGGTCAGACACTGTTGACCCGACGGCCTCGATCCTTTTC
CAGGTCCCTGGCGGCAGCGATGGCCCCAGTGGCGTCCTCGTCTGTGGGCATGAGAGCATCACCTACATGCACAGC
AATCAAGAGGCCTTGCGCGTCGCCATTCCTCGCCGCAGAGGGGCCCTCGAGGATCCGTCCCGGAAAAGGACCATT
GTCTCTGGCATCATGCACAAACTCAAAGGCAGTACTGGCGCCTTCTTTTTCCTCCTGCAAACCGAGGATGGCGAC
ATCTTCCGAGTCACCATGGACATGATTAAGGATCAGGATGGCAAGACGACGGGAGACGTCAAGCGACTCCTAATC
AAGTACTTTGACACCGTTCCTGTGGCCACCAGCTTCTGCATCCTCAAGAACGGCTTTCTATACGTTGCCAGTCAG
CACAGTGACCCCGGCTTCTATCAGTTCGAGAAGCTCGGCGATGATGACGACGAGCTCGAGTTCAACAGCGACCAA
TTTCCCGTTGATCACAAGGCGCCGTATGACCCCGTCTACTTCCATCCTCGCAAGGCAGACAACATCACACTGTTC
CAGAACGTTCCCTCCATGAACCCGCTCATGGACTGCAAGATCGCCAATCTGACCGGTGACGACGCGCCCCAGATC
TACACGGCCTGTGGCAGCGGAGCACGGAGCTCATTTCGCACGCTGAAGCATGGGCTTGACGTCACGCACATCGTC
GGCTCTCAGCTGCCCGGAACGCCATCGGCTGTGTGGACGCTGAAGCTGAAGCGAGACGACGAGTTTGACGCCTTC
CTGGTCCTCTCATTTGCCAACGTGTCTCTCATCCTTAGTATTGGAGAGACGGTGGAGCAGGTGGACGACTCGGGC
TTATTCACCGACATTCCCACTCTCGCAGCCCAGCTCCTCGGTGACGGCGGCCTGGTTCAAGTCCACGCCAAGGGC
ATCCGAGTCGTCCGCAACGGGCGGCCCGATGACTGGGACGCTCCCCAGCATCGCTCCATCGTCGCGGCCGCCACC
AACGCCCAGCAGGTGGCCATCGCCCTGAGCTCCGGCGAGATTATCTACTTCGAGGCCGACGAAGAGGGTAACCTC
AACGAATTTGAGGATCGAAAGGGCATGCGGGGGACCGTCACTTGCCTGAGCCTGGGTGACGTTCCCAATGGGAGG
CTCCGCAGCTCTTTTCTCGCCGTCGGCTGCGATGATTGCACCGTACGCATCCTCAGTCTGGATCACGGCTCGACG
CTCGAAAAGAAATCGGTTCAGGCCTTGACGGCCGCGCCCACGTCTTTGGCCATTATGAGTATGATCGACTCGTCT
TCGGGCGGCTCCACGCTCTACCTGCACATCGGACTGCATTCGGGCGTCTACCTGCGCACGGTTTTAGACGAGGTG
TCGGGCGAGCTGTCCGATACACGACAAAAGTTCCTGGGGCCCAAGCAGGTCGGGCTCTTCCAGCTCACCGTCGAG
GGCAAGACGTGCGTTCTGGCCCTGAGCTCCCGGCCCTGGCTCGGCTATCCGGATCCCATCACCAACAGCTTCACC
ATGGCGCCTCTGAACTATCCGGAGCTGGTCTGGGGCTGGAACTTTAAGAGCCCGCAGTGCAAGGAGGGACTCGTG
ACGATTCACGGACAAGACCTGAGCATTCTGTCGATTGACAGATTAGGAGACGCCTTCACTCAGAAGTCGATCCCT
CTTACTTACACTCCCAGGGCGCTCGTCAAGCATCCGGAGCAGCCCTTGTTCTACACCATTGAATCCGACAACAAC
ACGCTCCCAATCAACATACGGGAGCAGTTGCTCGCCGATCCCGCCGCGGTGAATGGCGATGCAACGACGCTCCCC
CCCAATGTCTTTGGTCACCCCAAAGGTAACCGTCACTGGGCGTCGTGCATCAGCGTCATCGACCCGATGGCCGAG
GACGAGAATGCCCGAGTGGTGCAGACGCTTCACCTGGACCAGAACGAGTCGGCCATCAGCGCCACCATTGTCCCG
TTCCTCGCCCAATATGGAGAGCATTTCCTGGTTGTCGGCGTCGGCAAAGACGTCATCATCAACCCTCGAAAATTC
TCCGAGGCTTCCATTCACGTCTATCGTCTCAACGACAACGGGCGTGAACTTGAGTTGGTTCACAAAACCCCGGTC
GAAGACTTGCCGTACGCGTTGTTGGCCTTTCAAGGGAGGGTACTCGTCGGAATCGGCAAGGTCTTGCGAGCATAC
GATCTCGGCATACGACAGCTGTTGCGCAAGTCGCATGCCGAGGTGGCGCCACAACAGATTGTGTCGCTCGGCACG
CAGGGGAACCGCATCATCGTCGGTGACATTCATCAGGGCATCACCTTTGTCATCTTCAAGCCTGCGACGAACAGG
CTGATTCCGTTCGCAGACGACGCCGTGCAGCGATGGATGACGTGCTCGACCATGGTCGACTACGAATCCGTCGCT
GGCGGTGACAAGTTTGGGAACCTCTTCCTGGTGCGATGCCCGCCCAAGGCCTCTCAGGAGGCGGACGAGGACGAC
TCGGGCGTTCACTTGGTCAACGCGCGGTCCTACATCCACGGGTGTCCCTGGCGACACGACCTCGTCTGCCACTTT
TTTACCAACGACATCCCCACCAACGTCACCAAGACCAGCCTCGTCGTCGGAGGTCAGGACGTGTTGCTGTGGAGC
GGACTCATGGGGACCATTGGCGTGCTCATCCCCCTCCTCAGCAGAGAGGATGCCGACTTCTTCCAGAGTCTGGAG
CAGCATCTCCGCAGCGAGGACCCGCCGTTGGCTGGCCGAGATCATCTGATGTACCGCGGCTACTATGCTCCGGTC
AAGGGCGTCATCGACGGTGACCTCTGCGAGCGGTACAACCTATTGACTCAGGAGAAGAAGGCCATGATTGCGGGA
GAGCTGGACCGATCTGTTCGGGAGATTGAGAGGAAGATTTCGGATCTCCGGACCCGATCTGCTTTCTAA
Gene >Ophcf2|04505
ATGGCTACGACTTCGAACCAGTTCCTTTACTCTTTGACGATCCAGCCTCCCAGTCACATCGTTCACGCGACTCTG
GGCCAGTTTGGTGGCACTCGAGAGCAGCTCATCATCACGGCTGCGGGCTCGCAATTGTCGCTGCTTCGCCCCGAT
CCTATTCAGGGCAAGGTGCACACGATCCTCACTCATAATGTCTTTGGCATCATTCGGTCTCTGGCCGCGTTTCGC
GTCACTGGTAGCAGCAAGGGTACCTTACCTTGGCTTTCGTTTCCCCTGACGAAGAGCCTTACTGATCTCTCATCG
CCATGTAGACTTTATCATCATCGCTTCCGATTCCGGTCGCGTGACAATTGTCGAGTACCTACCGGATAAGAATCG
CTTCTCTCGCGTACACATGGAAACTTATGGCAAGTCTGGCATCCGAAGAGTCGTTCCGGGCGAGTACCTGGTCTG
CGATCCCAAAGGTCGAGCCTTTCTCGTCGCCTCTGTGGAAAAGAACAAGCTCGTCTATGTTCTCAACCGTATCGC
GGGGGCTACCACCGAAGATAACCTCGCTGCCGAGCTCACCATATCCTCTCCCCTCGAAGCTCACAAGCCCGGCGT
TCTCGTCATCTCCATGGTGGCGCTTGACGTGGGATACTCCAACCCTGTCTTCGCTGCTCTCGAGGTCGACTGCTC
TGAAGTCGATCAGGACGCGACTGGAGAAGCACTCGAGGAACTCCAGACCCAGCTCGTGTATTACGAGCTCGACCT
TGGACTGAATTACGTCGTTCGCAAGTGGTCAGACACTGTTGACCCGACGGCCTCGATCCTTTTCCAGGTCCCTGG
CGGCAGCGATGGCCCCAGTGGCGTCCTCGTCTGTGGGCATGAGAGCATCACCTACATGCACAGCAATCAAGAGGC
CTTGCGCGTCGCCATTCCTCGCCGCAGAGGGGCCCTCGAGGATCCGTCCCGGAAAAGGACCATTGTCTCTGGCAT
CATGCACAAACTCAAAGGCAGTACTGGCGCCTTCTTTTTCCTCCTGCAAACCGAGGATGGCGACATCTTCCGAGT
CACCATGGACATGATTAAGGATCAGGATGGCAAGACGACGGGAGACGTCAAGCGACTCCTAATCAAGTACTTTGA
CACCGTTCCTGTGGCCACCAGCTTCTGCATCCTCAAGAACGGCTTTCTATACGTTGCCAGTCAGCACAGTGACCC
CGGCTTCTATCAGTTCGAGAAGCTCGGCGATGATGACGACGAGCTCGAGTTCAACAGCGACCAATTTCCCGTTGA
TCACAAGGCGCCGTATGACCCCGTCTACTTCCATCCTCGCAAGGCAGACAACATCACACTGTTCCAGAACGTTCC
CTCCATGAACCCGCTCATGGACTGCAAGATCGCCAATCTGACCGGTGACGACGCGCCCCAGATCTACACGGCCTG
TGGCAGCGGAGCACGGAGCTCATTTCGCACGCTGAAGCATGGGCTTGACGTCACGCACATCGTCGGCTCTCAGCT
GCCCGGAACGCCATCGGCTGTGTGGACGCTGAAGCTGAAGCGAGACGACGAGTTTGACGCCTTCCTGGTCCTCTC
ATTTGCCAACGTGTCTCTCATCCTTAGTATTGGAGAGACGGTGGAGCAGGTGGACGACTCGGGCTTATTCACCGA
CATTCCCACTCTCGCAGCCCAGCTCCTCGGTGACGGCGGCCTGGTTCAAGTCCACGCCAAGGGCATCCGAGTCGT
CCGCAACGGGCGGCCCGATGACTGGGACGCTCCCCAGCATCGCTCCATCGTCGCGGCCGCCACCAACGCCCAGCA
GGTGGCCATCGCCCTGAGCTCCGGCGAGATTATCTACTTCGAGGCCGACGAAGAGGGTAACCTCAACGAATTTGA
GGATCGAAAGGGCATGCGGGGGACCGTCACTTGCCTGAGCCTGGGTGACGTTCCCAATGGGAGGCTCCGCAGCTC
TTTTCTCGCCGTCGGCTGCGATGATTGCACCGTACGCATCCTCAGTCTGGATCACGGCTCGACGCTCGAAAAGAA
ATCGGTTCAGGCCTTGACGGCCGCGCCCACGTCTTTGGCCATTATGAGTATGATCGACTCGTCTTCGGGCGGCTC
CACGCTCTACCTGCACATCGGACTGCATTCGGGCGTCTACCTGCGCACGGTTTTAGACGAGGTGTCGGGCGAGCT
GTCCGATACACGACAAAAGTTCCTGGGGCCCAAGCAGGTCGGGCTCTTCCAGCTCACCGTCGAGGGCAAGACGTG
CGTTCTGGCCCTGAGCTCCCGGCCCTGGCTCGGCTATCCGGATCCCATCACCAACAGCTTCACCATGGCGCCTCT
GAACTATCCGGAGCTGGTCTGGGGCTGGAACTTTAAGAGCCCGCAGTGCAAGGAGGGACTCGTGACGATTCACGG
ACAAGACCTGAGGTGAGTCGAATGGATCGCTGCCACGTGCCGCTTCTGCTTCAACCTGTTGCGTGATGAAAAAGA
AACAACCCGATGCCCTGTGGGCCATGAGGCTTTACGCTTTATGTTTCATTTCTCCAATTGTTCCTACTGATGCTC
GCCCATCTAACTTCTCCGTCTGCCCATTGGTCTCTCAACGACTATACTGACAAAGTGATAGCATTCTGTCGATTG
ACAGATTAGGAGACGCCTTCACTCAGAAGTCGATCCCTCTTACTTACACTCCCAGGGCGCTCGTCAAGCATCCGG
AGCAGCCCTTGTTCTACACCATTGAATCCGACAACAACACGCTCCCAATCAACATACGGGAGCAGTTGCTCGCCG
ATCCCGCCGCGGTGAATGGCGATGCAACGACGCTCCCCCCCAATGTCTTTGGTCACCCCAAAGGTAACCGTCACT
GGGCGTCGTGCATCAGCGTCATCGACCCGATGGCCGAGGACGAGAATGCCCGAGTGGTGCAGACGCTTCACCTGG
ACCAGAACGAGTCGGCCATCAGCGCCACCATTGTCCCGTTCCTCGCCCAATATGGAGAGCATTTCCTGGTTGTCG
GCGTCGGCAAAGACGTCATCATCAACCCTCGAAAATTCTCCGAGGCTTCCATTCACGTCTATCGTCTCAACGACA
ACGGGCGTGAACTTGAGTTGGTTCACAAAACCCCGGTCGAAGACTTGCCGTACGCGTTGTTGGCCTTTCAAGGGA
GGGTACTCGTCGGAATCGGCAAGGTCTTGCGAGCATACGATCTCGGCATACGACAGCTGTTGCGCAAGTCGCATG
CCGAGGTGGCGCCACAACAGATTGTGTCGCTCGGCACGCAGGGGAACCGCATCATCGTCGGTGACATTCATCAGG
GCATCACCTTTGTCATCTTCAAGCCTGCGACGAACAGGCTGATTCCGTTCGCAGACGACGCCGTGCAGCGATGGA
TGACGTGCTCGACCATGGTCGACTACGAATCCGTCGCTGGCGGTGACAAGTTTGGGAACCTCTTCCTGGTGCGAT
GCCCGCCCAAGGCCTCTCAGGAGGCGGACGAGGACGACTCGGGCGTTCACTTGGTCAACGCGCGGTCCTACATCC
ACGGGTGTCCCTGGCGACACGACCTCGTCTGCCACTTTTTTACCAACGACATCCCCACCAACGTCACCAAGACCA
GCCTCGTCGTCGGAGGTCAGGACGTGTTGCTGTGGAGCGGACTCATGGGGACCATTGGCGTGCTCATCCCCCTCC
TCAGCAGAGAGGATGCCGACTTCTTCCAGAGTCTGGAGCAGCATCTCCGCAGCGAGGACCCGCCGTTGGCTGGCC
GAGATCATCTGATGTACCGCGGCTACTATGCTCCGGTCAAGGGCGTCATCGACGGTGACCTCTGCGAGCGGTACA
ACCTATTGACTCAGGAGAAGAAGGCCATGATTGCGGGAGAGCTGGACCGATCTGTTCGGGAGATTGAGAGGAAGA
TTTCGGTTTGTGGCTGATCAACGAGGATCGCGCATTCGAGGCTGACCAGATGATGCAGGATCTCCGGACCCGATC
TGCTTTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail