Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04504
Gene name
Locationscaffold_04:3436956..3437743
Strand+
Gene length (bp)787
Transcript length (bp)735
Coding sequence length (bp)735
Protein length (aa) 245

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14555 UBA_4 UBA-like domain 5.0E-05 175 214

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.49 0.5977 0.0305 0.1375 0.3235 0.0196 0.1967 0.3082 0.1417 0.0421

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2447
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6922
Ophiocordyceps australis map64 (Brazil) OphauB2|780
Ophiocordyceps camponoti-floridani Ophcf2|04504 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5646
Ophiocordyceps kimflemingae Ophio5|5811
Ophiocordyceps subramaniannii Hirsu2|35

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04504
MESCCTCATLLPTKAPISGTRLQCCARIVCEPCLQSNRRFATCCPYCQVSTAPSPLPQGLRDPPAYRSVASTRAS
TDPVAVTPPPPYSPSPAAKAEDKEASDIIHFLDHDHDTVSSLSLRYRVPAAVLRRVNNITSDQLLLGRKTILIPA
QYCANGVSLSPCPVLGEDEELRKSKIRRFMLACKVADYDVALLYLEQSDYHLRAAVDSYFDDESWERKHPRPCSG
DNAKVGRRQKRRLLPWLGL*
Coding >Ophcf2|04504
ATGGAAAGCTGCTGCACCTGCGCCACTCTACTCCCCACCAAGGCCCCCATCTCCGGCACAAGACTCCAATGCTGC
GCCAGAATCGTCTGCGAACCCTGCCTACAAAGCAACAGACGGTTCGCTACCTGCTGTCCCTACTGCCAAGTCTCG
ACCGCGCCCTCGCCTCTGCCGCAGGGACTCCGAGATCCTCCGGCATATAGGTCCGTTGCGTCCACGCGCGCCTCC
ACCGATCCCGTCGCCGTCACTCCGCCGCCTCCGTACTCCCCGTCTCCCGCTGCCAAGGCCGAAGACAAGGAGGCG
TCCGACATCATCCACTTCCTCGACCACGACCACGATACCGTCTCCTCCCTCTCGCTCCGCTACCGCGTTCCGGCG
GCGGTCCTGAGACGTGTCAACAACATCACCAGCGACCAGCTGCTCCTCGGCCGCAAGACCATTCTGATCCCCGCA
CAATATTGTGCGAACGGCGTCAGCCTGTCACCGTGTCCGGTCCTCGGCGAAGATGAGGAGCTGAGAAAGAGCAAG
ATTCGTCGCTTCATGTTAGCTTGCAAGGTTGCCGATTATGACGTCGCCCTGCTCTATCTCGAGCAGTCCGACTAC
CACCTGCGTGCCGCCGTAGACTCGTATTTTGACGACGAATCCTGGGAGAGAAAACATCCCAGACCATGTTCAGGC
GACAACGCCAAGGTCGGGAGACGGCAAAAAAGGCGCCTTCTTCCTTGGCTAGGACTGTGA
Transcript >Ophcf2|04504
ATGGAAAGCTGCTGCACCTGCGCCACTCTACTCCCCACCAAGGCCCCCATCTCCGGCACAAGACTCCAATGCTGC
GCCAGAATCGTCTGCGAACCCTGCCTACAAAGCAACAGACGGTTCGCTACCTGCTGTCCCTACTGCCAAGTCTCG
ACCGCGCCCTCGCCTCTGCCGCAGGGACTCCGAGATCCTCCGGCATATAGGTCCGTTGCGTCCACGCGCGCCTCC
ACCGATCCCGTCGCCGTCACTCCGCCGCCTCCGTACTCCCCGTCTCCCGCTGCCAAGGCCGAAGACAAGGAGGCG
TCCGACATCATCCACTTCCTCGACCACGACCACGATACCGTCTCCTCCCTCTCGCTCCGCTACCGCGTTCCGGCG
GCGGTCCTGAGACGTGTCAACAACATCACCAGCGACCAGCTGCTCCTCGGCCGCAAGACCATTCTGATCCCCGCA
CAATATTGTGCGAACGGCGTCAGCCTGTCACCGTGTCCGGTCCTCGGCGAAGATGAGGAGCTGAGAAAGAGCAAG
ATTCGTCGCTTCATGTTAGCTTGCAAGGTTGCCGATTATGACGTCGCCCTGCTCTATCTCGAGCAGTCCGACTAC
CACCTGCGTGCCGCCGTAGACTCGTATTTTGACGACGAATCCTGGGAGAGAAAACATCCCAGACCATGTTCAGGC
GACAACGCCAAGGTCGGGAGACGGCAAAAAAGGCGCCTTCTTCCTTGGCTAGGACTGTGA
Gene >Ophcf2|04504
ATGGAAAGCTGCTGCACCTGCGCCACTCTACTCCCCACCAAGGCCCCCATCTCCGGCACAAGACTCCAATGCTGC
GCCAGAATCGTCTGCGAACCCTGCCTACAAGTCCGTCCGTCCGTCAGGAAACCCATCTATTCATTCAGTTGACGC
CGTACAGAGCAACAGACGGTTCGCTACCTGCTGTCCCTACTGCCAAGTCTCGACCGCGCCCTCGCCTCTGCCGCA
GGGACTCCGAGATCCTCCGGCATATAGGTCCGTTGCGTCCACGCGCGCCTCCACCGATCCCGTCGCCGTCACTCC
GCCGCCTCCGTACTCCCCGTCTCCCGCTGCCAAGGCCGAAGACAAGGAGGCGTCCGACATCATCCACTTCCTCGA
CCACGACCACGATACCGTCTCCTCCCTCTCGCTCCGCTACCGCGTTCCGGCGGCGGTCCTGAGACGTGTCAACAA
CATCACCAGCGACCAGCTGCTCCTCGGCCGCAAGACCATTCTGATCCCCGCACAATATTGTGCGAACGGCGTCAG
CCTGTCACCGTGTCCGGTCCTCGGCGAAGATGAGGAGCTGAGAAAGAGCAAGATTCGTCGCTTCATGTTAGCTTG
CAAGGTTGCCGATTATGACGTCGCCCTGCTCTATCTCGAGCAGTCCGACTACCACCTGCGTGCCGCCGTAGACTC
GTATTTTGACGACGAATCCTGGGAGAGAAAACATCCCAGACCATGTTCAGGCGACAACGCCAAGGTCGGGAGACG
GCAAAAAAGGCGCCTTCTTCCTTGGCTAGGACTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail