Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04503
Gene name
Locationscaffold_04:3435006..3436580
Strand-
Gene length (bp)1574
Transcript length (bp)1473
Coding sequence length (bp)1473
Protein length (aa) 491

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20179 MSS51_C MSS51 C-terminal domain 3.2E-41 232 461
PF13824 zf-Mss51 Zinc-finger of mitochondrial splicing suppressor 51 7.0E-30 103 178

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2747 0.1652 0.0478 0.0735 0.8543 0.0584 0.0552 0.0502 0.1108 0.0323

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2526
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6925
Ophiocordyceps australis map64 (Brazil) OphauB2|782
Ophiocordyceps camponoti-floridani Ophcf2|04503 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5647
Ophiocordyceps kimflemingae Ophio5|5809
Ophiocordyceps subramaniannii Hirsu2|37

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04503
MESALRRATSTLCGRCSGFNGKRLVSKRPATPWPGVAGVNLRKSSSTAFTMSPDPRTEAAASQEGSGVKTSVLLK
PDNLFHPFSSSPVAEFRRRAAFMRQQAYCPHPDHQLARLPTVGPAQEGPSGKGGKMAPAHVDFECPDCGLPVYCS
KEHWMDDYDHHLEICDTLRQINEDDHDLRSGRVFHEALLADIQLEEALVNMESWDTFMYTREFRAINSDRSMRQI
TRLLTYPITIGSILHELSPYDIKNGRRLTVEGLKSLSALRYNLHPAKVGDRMSLKNPKLLPPPLRIFILGARAES
SLPRTFWIQLSHLFPMAGLHLIFIGPESMANRDDEFPLPKRTASNPFGAVVEAQIWSQLKISTIVDYFHTIHRTG
YFAPYDPYFDCFVLFHPGLGHPASSHEWEETLPMLLETKLPIICTGYTAFDLERDIEWVRKQSGGEFDVLLEPGE
NLFRSLRWDLNDMDPRDVSCGNWGVWAFRGKRYEATTKDE*
Coding >Ophcf2|04503
ATGGAATCAGCGCTGCGCCGAGCGACGTCGACGCTATGCGGTCGATGCTCTGGGTTCAATGGCAAGCGACTAGTC
TCCAAGAGGCCCGCGACGCCATGGCCAGGGGTTGCCGGGGTGAATCTGCGCAAGTCGAGTTCTACAGCTTTCACC
ATGAGCCCCGACCCGAGGACGGAGGCGGCAGCTTCTCAGGAAGGATCTGGGGTCAAGACTTCGGTTCTGCTGAAG
CCGGATAACCTGTTTCATCCCTTTTCGTCGTCTCCCGTGGCCGAGTTCAGGCGGCGGGCAGCTTTCATGAGGCAG
CAGGCATACTGCCCTCATCCAGATCATCAACTAGCTCGATTGCCGACCGTGGGACCTGCTCAGGAGGGACCGTCC
GGAAAGGGAGGGAAGATGGCTCCCGCACACGTGGACTTTGAGTGTCCTGACTGCGGATTGCCCGTCTACTGCAGC
AAGGAGCATTGGATGGACGACTACGATCACCACCTCGAGATTTGTGACACCCTGCGGCAGATTAACGAAGATGAT
CACGATCTCCGGTCTGGAAGGGTGTTTCATGAAGCCTTGCTCGCGGATATTCAGCTGGAAGAGGCTCTCGTCAAT
ATGGAGAGTTGGGATACGTTCATGTACACGAGGGAGTTTAGAGCGATTAACTCGGACAGGTCGATGCGACAGATT
ACTCGGCTCCTTACCTACCCAATCACCATCGGGAGCATACTTCACGAGCTGAGCCCATACGATATAAAAAACGGC
AGACGGCTTACTGTGGAGGGGTTGAAGAGTCTCAGCGCGCTCAGGTATAACCTACACCCCGCAAAGGTCGGAGAC
AGAATGAGCCTCAAGAACCCAAAACTGTTGCCTCCGCCCCTGAGAATCTTCATTCTGGGCGCGCGCGCAGAGTCG
TCGCTGCCACGAACGTTTTGGATACAGCTCTCTCATCTGTTCCCGATGGCGGGACTGCACCTCATCTTCATCGGG
CCGGAAAGCATGGCGAATCGAGACGACGAGTTTCCGTTGCCGAAGCGAACGGCTTCGAACCCTTTCGGCGCCGTG
GTCGAGGCTCAGATATGGTCTCAGTTGAAGATTAGCACGATTGTCGACTACTTCCACACGATCCACAGGACGGGC
TACTTTGCGCCGTACGATCCCTACTTTGACTGCTTCGTGCTATTCCACCCCGGCCTCGGACATCCGGCCAGCAGC
CACGAATGGGAAGAGACGCTCCCGATGCTCCTGGAGACCAAACTGCCCATCATCTGCACGGGCTACACGGCCTTT
GACCTGGAGCGGGACATTGAGTGGGTGCGCAAGCAGTCCGGGGGCGAGTTCGACGTGCTGCTGGAGCCGGGGGAG
AATCTGTTTCGCAGTCTGCGGTGGGACCTGAATGATATGGATCCGCGGGATGTGAGCTGCGGGAACTGGGGGGTT
TGGGCTTTTCGTGGGAAGAGGTATGAGGCGACGACCAAGGATGAGTAG
Transcript >Ophcf2|04503
ATGGAATCAGCGCTGCGCCGAGCGACGTCGACGCTATGCGGTCGATGCTCTGGGTTCAATGGCAAGCGACTAGTC
TCCAAGAGGCCCGCGACGCCATGGCCAGGGGTTGCCGGGGTGAATCTGCGCAAGTCGAGTTCTACAGCTTTCACC
ATGAGCCCCGACCCGAGGACGGAGGCGGCAGCTTCTCAGGAAGGATCTGGGGTCAAGACTTCGGTTCTGCTGAAG
CCGGATAACCTGTTTCATCCCTTTTCGTCGTCTCCCGTGGCCGAGTTCAGGCGGCGGGCAGCTTTCATGAGGCAG
CAGGCATACTGCCCTCATCCAGATCATCAACTAGCTCGATTGCCGACCGTGGGACCTGCTCAGGAGGGACCGTCC
GGAAAGGGAGGGAAGATGGCTCCCGCACACGTGGACTTTGAGTGTCCTGACTGCGGATTGCCCGTCTACTGCAGC
AAGGAGCATTGGATGGACGACTACGATCACCACCTCGAGATTTGTGACACCCTGCGGCAGATTAACGAAGATGAT
CACGATCTCCGGTCTGGAAGGGTGTTTCATGAAGCCTTGCTCGCGGATATTCAGCTGGAAGAGGCTCTCGTCAAT
ATGGAGAGTTGGGATACGTTCATGTACACGAGGGAGTTTAGAGCGATTAACTCGGACAGGTCGATGCGACAGATT
ACTCGGCTCCTTACCTACCCAATCACCATCGGGAGCATACTTCACGAGCTGAGCCCATACGATATAAAAAACGGC
AGACGGCTTACTGTGGAGGGGTTGAAGAGTCTCAGCGCGCTCAGGTATAACCTACACCCCGCAAAGGTCGGAGAC
AGAATGAGCCTCAAGAACCCAAAACTGTTGCCTCCGCCCCTGAGAATCTTCATTCTGGGCGCGCGCGCAGAGTCG
TCGCTGCCACGAACGTTTTGGATACAGCTCTCTCATCTGTTCCCGATGGCGGGACTGCACCTCATCTTCATCGGG
CCGGAAAGCATGGCGAATCGAGACGACGAGTTTCCGTTGCCGAAGCGAACGGCTTCGAACCCTTTCGGCGCCGTG
GTCGAGGCTCAGATATGGTCTCAGTTGAAGATTAGCACGATTGTCGACTACTTCCACACGATCCACAGGACGGGC
TACTTTGCGCCGTACGATCCCTACTTTGACTGCTTCGTGCTATTCCACCCCGGCCTCGGACATCCGGCCAGCAGC
CACGAATGGGAAGAGACGCTCCCGATGCTCCTGGAGACCAAACTGCCCATCATCTGCACGGGCTACACGGCCTTT
GACCTGGAGCGGGACATTGAGTGGGTGCGCAAGCAGTCCGGGGGCGAGTTCGACGTGCTGCTGGAGCCGGGGGAG
AATCTGTTTCGCAGTCTGCGGTGGGACCTGAATGATATGGATCCGCGGGATGTGAGCTGCGGGAACTGGGGGGTT
TGGGCTTTTCGTGGGAAGAGGTATGAGGCGACGACCAAGGATGAGTAG
Gene >Ophcf2|04503
ATGGAATCAGCGCTGCGCCGAGCGACGTCGACGCTATGCGGTCGATGCTCTGGGTTCAATGGCAAGCGACTAGTC
TCCAAGAGGCCCGCGACGCCATGGCCAGGGGTTGCCGGGGTGAATCTGCGCAAGTCGAGTTCTACAGCTTTCACC
ATGAGCCCCGACCCGAGGACGGAGGCGGCAGCTTCTCAGGAAGGATCTGGGGTCAAGACTTCGGTTCTGCTGAAG
CCGGATAACCTGTTTCATCCCTTTTCGTCGTCTCCCGTGGCCGAGTTCAGGCGGCGGGCAGCTTTCATGAGGCAG
CAGGCATACTGCCCTCATCCAGATCATCAACTAGCTCGATTGCCGACCGTGGGACCTGCTCAGGAGGGACCGTCC
GGAAAGGGAGGGAAGATGGCTCCCGCACACGTGGACTTTGAGTGTCCTGACTGCGGATTGCCCGTCTACTGCAGC
AAGGAGCATTGGATGGACGACTACGATCACCACCTCGAGATTTGTGACACCCTGCGGCAGATTAACGAAGATGAT
CACGATCTCCGGTCTGGAAGGGTGTTTCATGAAGCCTTGCTCGCGGATATTCAGCTGGAAGAGGCTCTCGTCAAT
ATGGAGAGTTGGGATACGTTCATGTACACGAGGGAGTTTAGAGCGATTAACTCGGACAGGTCGATGCGACAGATT
ACTCGGCTCCTTACCTACCCAATCACCATCGGGAGCATACTTCACGAGCTGAGCCCATACGATATAAAAAACGGC
AGACGGCTTACTGTGGAGGGGTTGAAGAGTCTCAGCGGTGCGTTGTCCTGAAGAAAGTCGAGGTCGAGCTCACAC
GTCACAGCGCTCAGGTATAACCTACACCCCGCAAAGGTCGGAGACAGAATGAGCCTCAAGAACCCAAAACTGTTG
CCTCCGCCCCTGAGAATCTTCATTCTGGGCGCGCGCGCAGAGTCGTCGCTGCCACGAACGTTTTGGATACAGCTC
TCTCATCTGTTCCCGATGGCGGGACTGCACCTCATCTTCATCGGGCCGGAAAGCATGGCGAATCGAGACGACGAG
TTTCCGTTGCCGAAGCGAACGGCTTCGAACCCTTTCGGCGCCGTGGTCGAGGCTCAGATATGGTCTCAGTTGAAG
ATTAGCACGATTGTCGACTACTTCCACACGATCCACAGGACGGGCTACTTTGCGCCGTACGATCCCTACTTTGAC
TGCTTCGTGCTATTCCACCCCGGCCTCGGACATCCGGCCAGCAGCCACGAATGGGAAGAGACGCTCCCGATGCTC
CTGGAGACCAAACTGCCCATCATCTGCACGGGCTACACGGCCTTTGACCTGGAGCGGGACATTGAGTGGGTGCGC
AAGCAGTCCGGGGGCGAGTTCGACGTGCTGCTGGAGCCGGGGGAGAATCTGTTTCGCAGTCTGCGGTGGGACCTG
AATGATATGGATCCGCGGGATGTGAGCTGCGGGAACTGGGGGGTTTGGGCTTTTCGTGGGAAGAGGTATGTTTCC
GATTCTGTCTTTGGGGGTTGTTGTGGGTGTGGACTGACGGGGGTAGGTATGAGGCGACGACCAAGGATGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail