Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04499
Gene name
Locationscaffold_04:3419126..3424102
Strand+
Gene length (bp)4976
Transcript length (bp)4821
Coding sequence length (bp)4821
Protein length (aa) 1607

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.2E-07 403 467
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.5E-12 410 500
PF13637 Ank_4 Ankyrin repeats (many copies) 1.1E-06 441 493
PF00023 Ank Ankyrin repeat 1.1E-04 440 470
PF13606 Ank_3 Ankyrin repeat 9.5E-04 440 467

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3901 0.8752 0.1612 0.0893 0.0429 0.0054 0.0377 0.0177 0.0078 0.0055

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3857
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1815
Ophiocordyceps australis map64 (Brazil) OphauB2|2431
Ophiocordyceps camponoti-floridani Ophcf2|04499 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6469
Ophiocordyceps kimflemingae Ophio5|5048
Ophiocordyceps subramaniannii Hirsu2|7635

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04499
MDAQNAAESDHSRPAGASPTQQPPPPPPPPPSLPPPPPPPPPPPPPGPDLDPRPQPPTSLKPAEPSPSDAPSPPP
PLALPPTTTIMNATRTPRPSSSRAKMVTRPQRLARPRPADALDKPAPAALTSSLAPAGNADPACKKRLPSLDKDR
HARLKDGGSSGLSSAPASPSANQPHPHHPPQQQQQQHPLHHQPSPQHHHRQHHLNHQHPYHQFQQPRRRSSDAAA
ASSPSDSENLKHHRSSSSNKASLRDKLKPGDRDRLAVPHKRKAPKTESDDETDHHRKARRQRTASVHLDGPRLPK
EARSTPAKPPHDTRPRSISPPPARQHRRSISTQLPLPSPNGLNLKKKRLPPPLLQPTDYQSDDSSAGDSALPRTS
KSRNPATPAALDANTSPAKMIPHKKHLDAHGQTLLARACARGEYETAKQRLQERPEDLNVADYAGNTPLQIAAIN
GCEDIVKLLIDAGCNLDCVNYDKDTPLLDAVDNGHLGVVNLLLDAGVNPRKANVNGEEPFDRVGDDTNNADEIRA
VLLAARKRAGERRRTSEDRHDSHDSHAPDSPRRSPPLAAAATGRRSGTVRSTKTRNDLLYMSLDDKTLRQAAGRG
DKETVARILQVKEGHDDPESMVAAARGGHDLVIQLLLGLGGANADPGPVPSLPSEFATPMLAAIGQENIKVVELL
LEQQGFDPTRKFKGETYYEIARRRQGTNWKEEEQMLKNSYDEYRRLHRDAVKTKSPVGRRERDRERDDRPPRRDD
HKDPSSKHPKRHASSPSREADARKKPSTASGTIRDKKKPDLPPSSRRGEGETHKRAPSRVKKDSSRVSDRENSPV
LHQKPLKTKRNESDLTGLSSEGEAAKPRRKLVSKGELSRERDRQKRAHKEASSPRDPKTDEAPADKSNALDKYHD
RAKALKRDLSRDHSPGEGTSSKRHRTSVSPDRPSDGDREQTHVEAPAKRRRLDGEASLDKRSTDGRPRKSGPPRD
ASRMLAEGKKDRDDGSKDSHDQRTSLQHGSTRVGSVVHVKSEDVDVPMPGTKQSADIDLLDAPPTAAEQSATENA
RRKDSAEQEAKREAERKRSEAEEKKRLEDEDKKKKKLEEAERKKKLEEVEKKKKAEEAERKKKAEEAERKKKAEE
AERKKKLEEAERKKTMEEAERKKRQQEEEEKRKKEEERARKAEEERTRREEEEARKRREQADRERREAEEAARLQ
EEERRRVEEQRKREEEEQRRREEEERLRKEQLEREAAEEAARRQREEEERRERAHREELERKRAAREAEQKRIRE
EQERVRLEKLPPLLRWLDLCPDPKIPAYADKFKQMLGPRYDTISPGHDGTAAGREQWVLNLHVALLLGEKDLNLS
RYTAWERTPVNSLCKMSMWRTEWLFWILKKEELWDLGRQIPGYYEKDPSLLGHYGFERLKDEAWPRFRDMDMFFV
KVSDLMYTVPNIPHLRNIRLAVAYREFQEHEGQGIRPYFKHRKDPNMERYFGFSPRNRYYVNGVFTGEDLPMDVQ
TSKTPFPEVRVPRRGLVRVYPGEADYEEICRKQGLEHLINKEPATPALPNGVHSSPGSQTTTMTTTTTTTTTMTP
AKAPSVNGTSGHSADEAATTNGVTMEGTEGP*
Coding >Ophcf2|04499
ATGGATGCGCAGAATGCCGCCGAGTCGGACCACTCGAGGCCTGCTGGCGCTTCACCCACTCAACAGCCGCCACCT
CCTCCTCCACCACCACCCTCGCTACCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCCCCCGGCCCCGACCTC
GATCCTAGGCCCCAGCCGCCGACCAGCCTGAAGCCTGCCGAACCCTCGCCCTCCGATGCTCCCTCCCCTCCTCCT
CCGCTCGCCCTCCCCCCGACGACGACGATCATGAACGCGACTCGGACGCCGAGACCATCGTCCTCCCGGGCAAAG
ATGGTCACTCGCCCTCAAAGGCTCGCAAGGCCCAGGCCCGCTGACGCCCTCGACAAGCCCGCCCCTGCTGCGCTT
ACCTCTTCTCTCGCTCCCGCTGGCAACGCCGACCCGGCTTGCAAGAAGCGCCTCCCGTCCCTGGACAAGGACCGT
CATGCTCGCCTCAAGGACGGTGGCTCCAGCGGCCTGAGTTCGGCCCCTGCGTCTCCGTCGGCCAACCAGCCGCAC
CCTCACCATCCACCTCAACAGCAACAACAGCAGCACCCGCTTCACCACCAGCCTTCGCCCCAGCATCATCATCGC
CAACACCACCTTAACCATCAGCACCCGTACCATCAATTTCAACAGCCTCGCAGGCGTAGCTCCGACGCTGCCGCC
GCCTCGTCGCCCTCCGACTCGGAGAACTTAAAACACCATAGGTCGTCGTCCTCCAACAAGGCCTCGTTGCGGGAC
AAGCTCAAGCCGGGCGACCGCGACCGCCTAGCCGTCCCCCACAAACGCAAGGCCCCCAAGACCGAGTCAGACGAC
GAGACGGATCATCATCGCAAAGCCCGTCGCCAGCGCACCGCCAGCGTCCACCTCGACGGCCCTCGGCTGCCCAAG
GAGGCCAGATCGACGCCCGCCAAGCCGCCTCACGATACCCGTCCGCGCTCCATTTCCCCCCCGCCCGCGCGACAG
CACAGGAGGAGTATCTCTACCCAGCTTCCCCTGCCCTCGCCCAACGGCCTGAACCTCAAGAAGAAGCGCCTACCG
CCGCCGCTGCTGCAGCCGACAGACTACCAGTCCGACGACTCCTCCGCCGGCGACAGCGCCCTACCGCGCACCTCA
AAGTCCCGCAACCCCGCTACCCCGGCCGCCTTGGATGCCAACACGTCCCCGGCCAAGATGATCCCCCACAAGAAG
CACCTCGACGCTCACGGCCAGACTCTACTGGCCCGTGCCTGCGCGCGCGGCGAGTACGAGACGGCTAAGCAGAGG
CTCCAGGAGCGGCCCGAGGACCTCAACGTCGCCGACTACGCCGGCAACACGCCGCTCCAGATCGCCGCGATTAAC
GGTTGCGAGGACATCGTCAAGCTCTTGATCGATGCCGGATGCAATCTGGACTGCGTCAACTACGACAAGGACACG
CCTCTACTGGATGCCGTCGACAACGGCCACCTCGGCGTCGTCAACCTCCTGCTCGACGCCGGCGTCAACCCTCGC
AAGGCAAACGTCAACGGGGAGGAGCCCTTCGATCGCGTCGGCGACGACACGAACAATGCCGACGAGATTCGCGCC
GTCCTCCTCGCCGCCCGAAAACGCGCAGGGGAGCGCCGGCGCACATCCGAGGACCGTCACGATTCTCACGACTCG
CACGCCCCGGATAGCCCTCGCCGATCGCCCCCCCTCGCCGCCGCCGCGACGGGGCGAAGGAGTGGTACCGTCCGC
TCCACCAAGACGCGAAACGACCTCTTGTACATGTCCCTCGACGACAAGACGCTGCGCCAGGCCGCCGGCCGCGGC
GACAAGGAAACCGTTGCACGCATCCTCCAGGTCAAGGAGGGCCACGATGATCCAGAGTCCATGGTTGCTGCCGCT
CGCGGCGGCCACGACTTGGTCATTCAGCTCCTGCTCGGCCTCGGTGGCGCCAACGCCGATCCTGGTCCCGTCCCG
TCACTTCCGTCCGAGTTTGCGACACCCATGCTGGCCGCCATCGGCCAAGAGAACATCAAGGTCGTTGAGCTGCTC
CTGGAGCAGCAAGGCTTCGATCCGACTCGAAAATTCAAGGGAGAGACCTATTACGAGATCGCCCGTCGCCGCCAG
GGCACCAATTGGAAAGAGGAAGAACAGATGCTCAAGAATTCATACGACGAGTACCGCCGATTGCACAGAGATGCC
GTCAAGACGAAATCGCCCGTTGGGCGACGCGAGCGCGACAGGGAAAGGGACGATAGACCGCCGAGGCGAGACGAC
CACAAGGACCCCTCTTCGAAACATCCGAAGCGACACGCCTCCAGCCCGTCCCGAGAGGCAGATGCTCGGAAGAAG
CCGTCGACGGCGTCTGGAACAATAAGGGACAAGAAGAAGCCCGATCTGCCCCCGTCGAGTCGGCGTGGAGAGGGC
GAGACGCACAAGCGAGCTCCAAGTCGCGTCAAGAAGGACTCATCCCGCGTCTCGGACCGCGAAAACTCCCCCGTG
CTTCACCAGAAGCCCCTGAAGACCAAGCGAAACGAGTCGGACCTGACTGGCCTGTCTTCTGAAGGGGAAGCTGCC
AAGCCGAGGAGGAAGCTTGTCTCGAAGGGGGAGCTGAGCCGGGAACGCGACAGGCAGAAGCGGGCCCACAAAGAA
GCCTCGAGCCCTCGCGACCCGAAGACCGACGAGGCTCCGGCCGACAAGTCAAATGCCCTGGACAAGTACCACGAC
AGAGCCAAGGCTCTGAAGCGAGATCTGTCGAGGGATCACTCACCCGGCGAAGGGACGTCGAGCAAGAGGCATCGA
ACGAGTGTGTCTCCCGACCGGCCCAGCGACGGCGACAGGGAACAAACTCACGTCGAGGCCCCGGCTAAGCGTCGG
CGGCTCGACGGCGAAGCCTCTTTGGACAAGCGATCGACGGACGGACGCCCACGCAAATCCGGTCCGCCTCGTGAC
GCCTCCAGAATGTTGGCGGAGGGCAAGAAGGATCGCGATGACGGGTCCAAAGACAGTCACGATCAGCGGACCTCT
CTTCAGCATGGCTCGACGCGAGTCGGCAGCGTCGTACACGTCAAGTCCGAAGACGTTGATGTGCCCATGCCTGGG
ACGAAGCAGTCCGCGGACATTGATCTTCTCGATGCCCCCCCGACGGCCGCCGAACAATCCGCAACGGAGAATGCG
CGGAGGAAAGACTCGGCGGAACAGGAAGCGAAGAGGGAGGCCGAACGAAAGCGATCCGAGGCCGAGGAGAAGAAG
AGACTCGAGGACGAGGACAAGAAGAAGAAGAAGCTTGAGGAGGCCGAGAGGAAGAAGAAGCTCGAGGAGGTAGAG
AAGAAGAAAAAGGCCGAGGAAGCGGAGAGGAAGAAAAAGGCCGAGGAAGCGGAGAGGAAGAAAAAGGCCGAGGAA
GCGGAGAGGAAGAAGAAGCTCGAGGAGGCCGAGAGGAAGAAGACGATGGAGGAAGCGGAGAGGAAGAAGAGGCAG
CAAGAAGAAGAGGAGAAAAGGAAGAAGGAAGAAGAGAGAGCTCGCAAGGCCGAAGAGGAGAGGACCCGGCGCGAA
GAGGAAGAAGCTCGAAAACGCCGGGAGCAGGCCGACCGCGAACGCCGTGAGGCTGAAGAGGCCGCCCGGCTTCAG
GAGGAAGAGCGACGGCGGGTGGAGGAACAGAGGAAGAGGGAGGAGGAAGAACAGCGACGACGCGAAGAGGAAGAA
CGGTTGCGCAAGGAGCAGCTCGAACGCGAAGCCGCTGAGGAGGCGGCCCGCCGACAGCGCGAGGAGGAAGAGCGC
CGAGAACGAGCGCATCGCGAGGAGCTCGAGCGGAAGCGCGCGGCGCGAGAAGCCGAGCAGAAGCGCATCCGCGAG
GAACAGGAACGCGTCCGGCTCGAAAAGCTTCCGCCTCTGCTCCGATGGCTCGACCTGTGTCCCGACCCCAAGATT
CCGGCCTATGCCGACAAGTTTAAGCAAATGCTGGGTCCGCGATACGACACCATCAGCCCCGGACACGACGGCACC
GCTGCCGGCCGCGAGCAATGGGTTCTCAACCTGCACGTGGCATTGCTCCTCGGCGAGAAGGACCTGAATCTCTCT
AGATACACGGCCTGGGAACGGACGCCAGTCAACAGCCTCTGCAAGATGAGCATGTGGCGGACCGAATGGCTCTTC
TGGATCTTGAAGAAGGAGGAGCTCTGGGACTTGGGCCGACAAATCCCGGGCTACTACGAGAAGGATCCGTCCTTG
TTGGGCCATTACGGGTTTGAACGGCTCAAGGATGAAGCATGGCCGAGATTTCGCGACATGGACATGTTCTTCGTC
AAGGTGTCTGATCTCATGTATACCGTGCCCAACATACCGCACCTGCGAAACATCCGGCTTGCGGTAGCGTATCGC
GAGTTCCAGGAACACGAGGGGCAGGGCATCAGGCCCTACTTCAAGCACAGAAAAGACCCCAACATGGAGCGCTAC
TTTGGATTCTCTCCTCGCAACAGATACTATGTCAACGGAGTCTTTACGGGCGAAGATCTGCCCATGGACGTGCAG
ACGAGCAAGACGCCCTTCCCGGAGGTTCGGGTGCCGCGCCGAGGCCTGGTGCGCGTCTATCCCGGCGAAGCGGAC
TACGAGGAGATATGCAGGAAGCAAGGCCTGGAGCATCTCATAAATAAGGAGCCTGCCACGCCCGCCTTGCCGAAC
GGGGTCCACTCGTCGCCCGGCAGTCAGACTACGACGATGACGACGACGACGACGACTACGACGACCATGACTCCG
GCCAAGGCCCCATCTGTCAACGGCACCAGCGGGCATTCGGCAGACGAGGCCGCCACGACTAATGGAGTGACGATG
GAAGGCACCGAAGGTCCTTGA
Transcript >Ophcf2|04499
ATGGATGCGCAGAATGCCGCCGAGTCGGACCACTCGAGGCCTGCTGGCGCTTCACCCACTCAACAGCCGCCACCT
CCTCCTCCACCACCACCCTCGCTACCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCCCCCGGCCCCGACCTC
GATCCTAGGCCCCAGCCGCCGACCAGCCTGAAGCCTGCCGAACCCTCGCCCTCCGATGCTCCCTCCCCTCCTCCT
CCGCTCGCCCTCCCCCCGACGACGACGATCATGAACGCGACTCGGACGCCGAGACCATCGTCCTCCCGGGCAAAG
ATGGTCACTCGCCCTCAAAGGCTCGCAAGGCCCAGGCCCGCTGACGCCCTCGACAAGCCCGCCCCTGCTGCGCTT
ACCTCTTCTCTCGCTCCCGCTGGCAACGCCGACCCGGCTTGCAAGAAGCGCCTCCCGTCCCTGGACAAGGACCGT
CATGCTCGCCTCAAGGACGGTGGCTCCAGCGGCCTGAGTTCGGCCCCTGCGTCTCCGTCGGCCAACCAGCCGCAC
CCTCACCATCCACCTCAACAGCAACAACAGCAGCACCCGCTTCACCACCAGCCTTCGCCCCAGCATCATCATCGC
CAACACCACCTTAACCATCAGCACCCGTACCATCAATTTCAACAGCCTCGCAGGCGTAGCTCCGACGCTGCCGCC
GCCTCGTCGCCCTCCGACTCGGAGAACTTAAAACACCATAGGTCGTCGTCCTCCAACAAGGCCTCGTTGCGGGAC
AAGCTCAAGCCGGGCGACCGCGACCGCCTAGCCGTCCCCCACAAACGCAAGGCCCCCAAGACCGAGTCAGACGAC
GAGACGGATCATCATCGCAAAGCCCGTCGCCAGCGCACCGCCAGCGTCCACCTCGACGGCCCTCGGCTGCCCAAG
GAGGCCAGATCGACGCCCGCCAAGCCGCCTCACGATACCCGTCCGCGCTCCATTTCCCCCCCGCCCGCGCGACAG
CACAGGAGGAGTATCTCTACCCAGCTTCCCCTGCCCTCGCCCAACGGCCTGAACCTCAAGAAGAAGCGCCTACCG
CCGCCGCTGCTGCAGCCGACAGACTACCAGTCCGACGACTCCTCCGCCGGCGACAGCGCCCTACCGCGCACCTCA
AAGTCCCGCAACCCCGCTACCCCGGCCGCCTTGGATGCCAACACGTCCCCGGCCAAGATGATCCCCCACAAGAAG
CACCTCGACGCTCACGGCCAGACTCTACTGGCCCGTGCCTGCGCGCGCGGCGAGTACGAGACGGCTAAGCAGAGG
CTCCAGGAGCGGCCCGAGGACCTCAACGTCGCCGACTACGCCGGCAACACGCCGCTCCAGATCGCCGCGATTAAC
GGTTGCGAGGACATCGTCAAGCTCTTGATCGATGCCGGATGCAATCTGGACTGCGTCAACTACGACAAGGACACG
CCTCTACTGGATGCCGTCGACAACGGCCACCTCGGCGTCGTCAACCTCCTGCTCGACGCCGGCGTCAACCCTCGC
AAGGCAAACGTCAACGGGGAGGAGCCCTTCGATCGCGTCGGCGACGACACGAACAATGCCGACGAGATTCGCGCC
GTCCTCCTCGCCGCCCGAAAACGCGCAGGGGAGCGCCGGCGCACATCCGAGGACCGTCACGATTCTCACGACTCG
CACGCCCCGGATAGCCCTCGCCGATCGCCCCCCCTCGCCGCCGCCGCGACGGGGCGAAGGAGTGGTACCGTCCGC
TCCACCAAGACGCGAAACGACCTCTTGTACATGTCCCTCGACGACAAGACGCTGCGCCAGGCCGCCGGCCGCGGC
GACAAGGAAACCGTTGCACGCATCCTCCAGGTCAAGGAGGGCCACGATGATCCAGAGTCCATGGTTGCTGCCGCT
CGCGGCGGCCACGACTTGGTCATTCAGCTCCTGCTCGGCCTCGGTGGCGCCAACGCCGATCCTGGTCCCGTCCCG
TCACTTCCGTCCGAGTTTGCGACACCCATGCTGGCCGCCATCGGCCAAGAGAACATCAAGGTCGTTGAGCTGCTC
CTGGAGCAGCAAGGCTTCGATCCGACTCGAAAATTCAAGGGAGAGACCTATTACGAGATCGCCCGTCGCCGCCAG
GGCACCAATTGGAAAGAGGAAGAACAGATGCTCAAGAATTCATACGACGAGTACCGCCGATTGCACAGAGATGCC
GTCAAGACGAAATCGCCCGTTGGGCGACGCGAGCGCGACAGGGAAAGGGACGATAGACCGCCGAGGCGAGACGAC
CACAAGGACCCCTCTTCGAAACATCCGAAGCGACACGCCTCCAGCCCGTCCCGAGAGGCAGATGCTCGGAAGAAG
CCGTCGACGGCGTCTGGAACAATAAGGGACAAGAAGAAGCCCGATCTGCCCCCGTCGAGTCGGCGTGGAGAGGGC
GAGACGCACAAGCGAGCTCCAAGTCGCGTCAAGAAGGACTCATCCCGCGTCTCGGACCGCGAAAACTCCCCCGTG
CTTCACCAGAAGCCCCTGAAGACCAAGCGAAACGAGTCGGACCTGACTGGCCTGTCTTCTGAAGGGGAAGCTGCC
AAGCCGAGGAGGAAGCTTGTCTCGAAGGGGGAGCTGAGCCGGGAACGCGACAGGCAGAAGCGGGCCCACAAAGAA
GCCTCGAGCCCTCGCGACCCGAAGACCGACGAGGCTCCGGCCGACAAGTCAAATGCCCTGGACAAGTACCACGAC
AGAGCCAAGGCTCTGAAGCGAGATCTGTCGAGGGATCACTCACCCGGCGAAGGGACGTCGAGCAAGAGGCATCGA
ACGAGTGTGTCTCCCGACCGGCCCAGCGACGGCGACAGGGAACAAACTCACGTCGAGGCCCCGGCTAAGCGTCGG
CGGCTCGACGGCGAAGCCTCTTTGGACAAGCGATCGACGGACGGACGCCCACGCAAATCCGGTCCGCCTCGTGAC
GCCTCCAGAATGTTGGCGGAGGGCAAGAAGGATCGCGATGACGGGTCCAAAGACAGTCACGATCAGCGGACCTCT
CTTCAGCATGGCTCGACGCGAGTCGGCAGCGTCGTACACGTCAAGTCCGAAGACGTTGATGTGCCCATGCCTGGG
ACGAAGCAGTCCGCGGACATTGATCTTCTCGATGCCCCCCCGACGGCCGCCGAACAATCCGCAACGGAGAATGCG
CGGAGGAAAGACTCGGCGGAACAGGAAGCGAAGAGGGAGGCCGAACGAAAGCGATCCGAGGCCGAGGAGAAGAAG
AGACTCGAGGACGAGGACAAGAAGAAGAAGAAGCTTGAGGAGGCCGAGAGGAAGAAGAAGCTCGAGGAGGTAGAG
AAGAAGAAAAAGGCCGAGGAAGCGGAGAGGAAGAAAAAGGCCGAGGAAGCGGAGAGGAAGAAAAAGGCCGAGGAA
GCGGAGAGGAAGAAGAAGCTCGAGGAGGCCGAGAGGAAGAAGACGATGGAGGAAGCGGAGAGGAAGAAGAGGCAG
CAAGAAGAAGAGGAGAAAAGGAAGAAGGAAGAAGAGAGAGCTCGCAAGGCCGAAGAGGAGAGGACCCGGCGCGAA
GAGGAAGAAGCTCGAAAACGCCGGGAGCAGGCCGACCGCGAACGCCGTGAGGCTGAAGAGGCCGCCCGGCTTCAG
GAGGAAGAGCGACGGCGGGTGGAGGAACAGAGGAAGAGGGAGGAGGAAGAACAGCGACGACGCGAAGAGGAAGAA
CGGTTGCGCAAGGAGCAGCTCGAACGCGAAGCCGCTGAGGAGGCGGCCCGCCGACAGCGCGAGGAGGAAGAGCGC
CGAGAACGAGCGCATCGCGAGGAGCTCGAGCGGAAGCGCGCGGCGCGAGAAGCCGAGCAGAAGCGCATCCGCGAG
GAACAGGAACGCGTCCGGCTCGAAAAGCTTCCGCCTCTGCTCCGATGGCTCGACCTGTGTCCCGACCCCAAGATT
CCGGCCTATGCCGACAAGTTTAAGCAAATGCTGGGTCCGCGATACGACACCATCAGCCCCGGACACGACGGCACC
GCTGCCGGCCGCGAGCAATGGGTTCTCAACCTGCACGTGGCATTGCTCCTCGGCGAGAAGGACCTGAATCTCTCT
AGATACACGGCCTGGGAACGGACGCCAGTCAACAGCCTCTGCAAGATGAGCATGTGGCGGACCGAATGGCTCTTC
TGGATCTTGAAGAAGGAGGAGCTCTGGGACTTGGGCCGACAAATCCCGGGCTACTACGAGAAGGATCCGTCCTTG
TTGGGCCATTACGGGTTTGAACGGCTCAAGGATGAAGCATGGCCGAGATTTCGCGACATGGACATGTTCTTCGTC
AAGGTGTCTGATCTCATGTATACCGTGCCCAACATACCGCACCTGCGAAACATCCGGCTTGCGGTAGCGTATCGC
GAGTTCCAGGAACACGAGGGGCAGGGCATCAGGCCCTACTTCAAGCACAGAAAAGACCCCAACATGGAGCGCTAC
TTTGGATTCTCTCCTCGCAACAGATACTATGTCAACGGAGTCTTTACGGGCGAAGATCTGCCCATGGACGTGCAG
ACGAGCAAGACGCCCTTCCCGGAGGTTCGGGTGCCGCGCCGAGGCCTGGTGCGCGTCTATCCCGGCGAAGCGGAC
TACGAGGAGATATGCAGGAAGCAAGGCCTGGAGCATCTCATAAATAAGGAGCCTGCCACGCCCGCCTTGCCGAAC
GGGGTCCACTCGTCGCCCGGCAGTCAGACTACGACGATGACGACGACGACGACGACTACGACGACCATGACTCCG
GCCAAGGCCCCATCTGTCAACGGCACCAGCGGGCATTCGGCAGACGAGGCCGCCACGACTAATGGAGTGACGATG
GAAGGCACCGAAGGTCCTTGA
Gene >Ophcf2|04499
ATGGATGCGCAGAATGCCGCCGAGTCGGACCACTCGAGGCCTGCTGGCGCTTCACCCACTCAACAGCCGCCACCT
CCTCCTCCACCACCACCCTCGCTACCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCCCCCGGCCCCGACCTC
GATCCTAGGCCCCAGCCGCCGACCAGCCTGAAGCCTGCCGAACCCTCGCCCTCCGATGCTCCCTCCCCTCCTCCT
CCGCTCGCCCTCCCCCCGACGACGACGATCATGAACGCGACTCGGACGCCGAGACCATCGTCCTCCCGGGCAAAG
ATGGTCACTCGCCCTCAAAGGCTCGCAAGGTTCGACAGGAGGACAGGAGCGAGAGCGACGGTGACGCCCCCAAGC
CCAGGCCCAGGCCCGCTGACGCCCTCGACAAGCCCGCCCCTGCTGCGCTTACCTCTTCTCTCGCTCCCGCTGGCA
ACGCCGACCCGGCTTGCAAGAAGCGCCTCCCGTCCCTGGACAAGGACCGTCATGCTCGCCTCAAGGACGGTGGCT
CCAGCGGCCTGAGTTCGGCCCCTGCGTCTCCGTCGGCCAACCAGCCGCACCCTCACCATCCACCTCAACAGCAAC
AACAGCAGCACCCGCTTCACCACCAGCCTTCGCCCCAGCATCATCATCGCCAACACCACCTTAACCATCAGCACC
CGTACCATCAATTTCAACAGCCTCGCAGGCGTAGCTCCGACGCTGCCGCCGCCTCGTCGCCCTCCGACTCGGAGA
ACTTAAAACACCATAGGTCGTCGTCCTCCAACAAGGCCTCGTTGCGGGACAAGCTCAAGCCGGGCGACCGCGACC
GCCTAGCCGTCCCCCACAAACGCAAGGCCCCCAAGACCGAGTCAGACGACGAGACGGATCATCATCGCAAAGCCC
GTCGCCAGCGCACCGCCAGCGTCCACCTCGACGGCCCTCGGCTGCCCAAGGAGGCCAGATCGACGCCCGCCAAGC
CGCCTCACGATACCCGTCCGCGCTCCATTTCCCCCCCGCCCGCGCGACAGCACAGGAGGAGTATCTCTACCCAGC
TTCCCCTGCCCTCGCCCAACGGCCTGAACCTCAAGAAGAAGCGCCTACCGCCGCCGCTGCTGCAGCCGACAGACT
ACCAGTCCGACGACTCCTCCGCCGGCGACAGCGCCCTACCGCGCACCTCAAAGTCCCGCAACCCCGCTACCCCGG
CCGCCTTGGATGCCAACACGTCCCCGGCCAAGATGATCCCCCACAAGAAGCACCTCGACGCTCACGGCCAGACTC
TACTGGCCCGTGCCTGCGCGCGCGGCGAGTACGAGACGGCTAAGCAGAGGCTCCAGGAGCGGCCCGAGGACCTCA
ACGTCGCCGACTACGCCGGCAACACGCCGCTCCAGATCGCCGCGATTAACGGTTGCGAGGACATCGTCAAGCTCT
TGATCGATGCCGGATGCAATCTGGACTGCGTCAACTACGACAAGGACACGCCTCTACTGGATGCCGTCGACAACG
GCCACCTCGGCGTCGTCAACCTCCTGCTCGACGCCGGCGTCAACCCTCGCAAGGCAAACGTCAACGGGGAGGAGC
CCTTCGATCGCGTCGGCGACGACACGAACAATGCCGACGAGATTCGCGCCGTCCTCCTCGCCGCCCGAAAACGCG
CAGGGGAGCGCCGGCGCACATCCGAGGACCGTCACGATTCTCACGACTCGCACGCCCCGGATAGCCCTCGCCGAT
CGCCCCCCCTCGCCGCCGCCGCGACGGGGCGAAGGAGTGGTACCGTCCGCTCCACCAAGACGCGAAACGACCTCT
TGTACATGTCCCTCGACGACAAGACGCTGCGCCAGGCCGCCGGCCGCGGCGACAAGGAAACCGTTGCACGCATCC
TCCAGGTCAAGGAGGGCCACGATGATCCAGAGTCCATGGTTGCTGCCGCTCGCGGCGGCCACGACTTGGTCATTC
AGCTCCTGCTCGGCCTCGGTGGCGCCAACGCCGATCCTGGTCCCGTCCCGTCACTTCCGTCCGAGTTTGCGACAC
CCATGCTGGCCGCCATCGGCCAAGAGAACATCAAGGTCGTTGAGCTGCTCCTGGAGCAGCAAGGCTTCGATCCGA
CTCGAAAATTCAAGGGAGAGACCTATTACGAGATCGCCCGTCGCCGCCAGGGCACCAATTGGAAAGAGGAAGAAC
AGATGCTCAAGAATTCATACGACGAGTACCGCCGATTGCACAGAGATGCCGTCAAGACGAAATCGCCCGTTGGGC
GACGCGAGCGCGACAGGGAAAGGGACGATAGACCGCCGAGGCGAGACGACCACAAGGACCCCTCTTCGAAACATC
CGAAGCGACACGCCTCCAGCCCGTCCCGAGAGGCAGATGCTCGGAAGAAGCCGTCGACGGCGTCTGGAACAATAA
GGGACAAGAAGAAGCCCGATCTGCCCCCGTCGAGTCGGCGTGGAGAGGGCGAGACGCACAAGCGAGCTCCAAGTC
GCGTCAAGAAGGACTCATCCCGCGTCTCGGACCGCGAAAACTCCCCCGTGCTTCACCAGAAGCCCCTGAAGACCA
AGCGAAACGAGTCGGACCTGACTGGCCTGTCTTCTGAAGGGGAAGCTGCCAAGCCGAGGAGGAAGCTTGTCTCGA
AGGGGGAGCTGAGCCGGGAACGCGACAGGCAGAAGCGGGCCCACAAAGAAGCCTCGAGCCCTCGCGACCCGAAGA
CCGACGAGGCTCCGGCCGACAAGTCAAATGCCCTGGACAAGTACCACGACAGAGCCAAGGCTCTGAAGCGAGATC
TGTCGAGGGATCACTCACCCGGCGAAGGGACGTCGAGCAAGAGGCATCGAACGAGTGTGTCTCCCGACCGGCCCA
GCGACGGCGACAGGGAACAAACTCACGTCGAGGCCCCGGCTAAGCGTCGGCGGCTCGACGGCGAAGCCTCTTTGG
ACAAGCGATCGACGGACGGACGCCCACGCAAATCCGGTCCGCCTCGTGACGCCTCCAGAATGTTGGCGGAGGGCA
AGAAGGATCGCGATGACGGGTCCAAAGACAGTCACGATCAGCGGACCTCTCTTCAGCATGGCTCGACGCGAGTCG
GCAGCGTCGTACACGTCAAGTCCGAAGACGTTGATGTGCCCATGCCTGGGACGAAGCAGTCCGCGGACATTGATC
TTCTCGATGCCCCCCCGACGGCCGCCGAACAATCCGCAACGGAGAATGCGCGGAGGAAAGACTCGGCGGAACAGG
AAGCGAAGAGGGAGGCCGAACGAAAGCGATCCGAGGCCGAGGAGAAGAAGAGACTCGAGGACGAGGACAAGAAGA
AGAAGAAGCTTGAGGAGGCCGAGAGGAAGAAGAAGCTCGAGGAGGTAGAGAAGAAGAAAAAGGCCGAGGAAGCGG
AGAGGAAGAAAAAGGCCGAGGAAGCGGAGAGGAAGAAAAAGGCCGAGGAAGCGGAGAGGAAGAAGAAGCTCGAGG
AGGCCGAGAGGAAGAAGACGATGGAGGAAGCGGAGAGGAAGAAGAGGCAGCAAGAAGAAGAGGAGAAAAGGAAGA
AGGAAGAAGAGAGAGCTCGCAAGGCCGAAGAGGAGAGGACCCGGCGCGAAGAGGAAGAAGCTCGAAAACGCCGGG
AGCAGGCCGACCGCGAACGCCGTGAGGCTGAAGAGGCCGCCCGGCTTCAGGAGGAAGAGCGACGGCGGGTGGAGG
AACAGAGGAAGAGGGAGGAGGAAGAACAGCGACGACGCGAAGAGGAAGAACGGTTGCGCAAGGAGCAGCTCGAAC
GCGAAGCCGCTGAGGAGGCGGCCCGCCGACAGCGCGAGGAGGAAGAGCGCCGAGAACGAGCGCATCGCGAGGAGC
TCGAGCGGAAGCGCGCGGCGCGAGAAGCCGAGCAGAAGCGCATCCGCGAGGAACAGGAACGCGTCCGGCTCGAAA
AGCTTCCGCCTCTGCTCCGATGGCTCGACCTGTGTCCCGACCCCAAGATTCCGGCCTATGCCGACAAGTTTAAGC
AAATGCTGGGTCCGCGATACGACACCATCAGCCCCGGACACGACGGCACCGCTGCCGGCCGCGAGCAATGGGTTC
TCAACCTGCACGTGGCATTGCTCCTCGGCGAGAAGGACCTGAATCTCTCTAGATGTACGTCATCCCTTACCCCTT
TTCGAGGCCTTGGCTAATTTCAGCGCTCCAAGACACGGCCTGGGAACGGACGCCAGTCAACAGCCTCTGCAAGAT
GAGCATGTGGCGGACCGAATGGCTCTTCTGGATCTTGAAGAAGGAGGAGCTCTGGGACTTGGGCCGACAAATCCC
GGGCTACTACGAGAAGGATCCGTCCTTGTTGGGCCATTACGGGTTTGAACGGCTCAAGGATGAAGCATGGCCGAG
ATTTCGCGACATGGACATGTTCTTCGTCAAGGTACGTCGGGATGTCCTGGAAAGGAGTCGAAGATGCTGACCGCC
GAATCCAGGTGTCTGATCTCATGTATACCGTGCCCAACATACCGCACCTGCGAAACATCCGGCTTGCGGTAGCGT
ATCGCGAGTTCCAGGAACACGAGGGGCAGGGCATCAGGCCCTACTTCAAGCACAGAAAAGACCCCAACATGGAGC
GCTACTTTGGATTCTCTCCTCGCAACAGATACTATGTCAACGGAGTCTTTACGGGCGAAGATCTGCCCATGGACG
TGCAGACGAGCAAGACGCCCTTCCCGGAGGTTCGGGTGCCGCGCCGAGGCCTGGTGCGCGTCTATCCCGGCGAAG
CGGACTACGAGGAGATATGCAGGAAGCAAGGCCTGGAGCATCTCATAAATAAGGAGCCTGCCACGCCCGCCTTGC
CGAACGGGGTCCACTCGTCGCCCGGCAGTCAGACTACGACGATGACGACGACGACGACGACTACGACGACCATGA
CTCCGGCCAAGGCCCCATCTGTCAACGGCACCAGCGGGCATTCGGCAGACGAGGCCGCCACGACTAATGGAGTGA
CGATGGAAGGCACCGAAGGTCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail