Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04497
Gene name
Locationscaffold_04:3415384..3416347
Strand+
Gene length (bp)963
Transcript length (bp)897
Coding sequence length (bp)897
Protein length (aa) 299

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02544 Steroid_dh 3-oxo-5-alpha-steroid 4-dehydrogenase 1.8E-14 184 298

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 67 85 18
3 146 168 22
4 178 200 22
5 221 240 19
6 250 269 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04497
MAITPSPALCCQTIFLANSAVLLAAHLLPPQLRHRLLQYGARGSEPPVGHDAPRLLSFIVNLQVPHAWFWHFYLE
SLLWSLVWAWQYRGRGTLMGGLARAQLASSHVSSVDLGRVCLAWAMFAAQGSRRLLECLFVMRPGKSSMSWAHWL
LGLGHYALVNLSIWIHGSGGILESWTVSVPAVLLTPRNLLCLTVFLAAWLEQNKCHRHLASLPKYTLPTEGLFRL
FVCPHYTCECVMYLALALVAAPPDGLFNPSLLCVFVFVVTNLGITARNSEKWYEEKFGRDKLAGRWKMIPFAF*
Coding >Ophcf2|04497
ATGGCCATAACCCCATCGCCCGCCCTCTGCTGCCAGACCATCTTCCTCGCCAACTCGGCAGTCCTCCTGGCCGCT
CACCTCCTCCCCCCGCAGCTCCGCCACCGGCTCCTCCAGTACGGTGCCCGCGGATCCGAGCCCCCGGTGGGCCAT
GACGCGCCCAGGCTGCTGTCCTTCATCGTCAACCTGCAGGTGCCGCACGCCTGGTTCTGGCACTTTTACCTTGAA
TCCCTTCTTTGGTCTCTTGTGTGGGCTTGGCAGTATCGAGGTCGGGGGACTTTGATGGGGGGGCTGGCCAGGGCG
CAGCTCGCTTCTTCGCATGTCTCGTCGGTTGACTTGGGGCGCGTTTGTCTGGCCTGGGCCATGTTCGCTGCTCAG
GGCTCTAGACGGCTGCTCGAATGCCTCTTTGTCATGCGGCCGGGCAAATCGTCCATGTCGTGGGCTCACTGGCTC
CTAGGTCTGGGTCATTACGCTCTCGTCAACCTGTCCATCTGGATACATGGCTCGGGTGGCATTCTCGAGTCCTGG
ACCGTATCGGTACCTGCTGTCCTGCTCACGCCGCGAAACTTGCTGTGCTTGACCGTCTTTCTGGCCGCCTGGCTC
GAACAAAACAAATGCCATCGTCATCTCGCCAGTCTTCCTAAATACACGCTTCCCACCGAGGGCTTGTTCCGTCTC
TTCGTCTGCCCTCACTACACGTGCGAGTGTGTCATGTATCTAGCGCTAGCCCTCGTTGCCGCCCCTCCCGACGGC
CTCTTCAACCCGAGCCTGCTCTGCGTCTTCGTCTTCGTCGTTACCAATCTCGGCATTACGGCTCGAAACTCGGAG
AAATGGTACGAGGAAAAATTCGGAAGAGATAAGCTGGCTGGCCGGTGGAAGATGATTCCTTTTGCCTTTTAG
Transcript >Ophcf2|04497
ATGGCCATAACCCCATCGCCCGCCCTCTGCTGCCAGACCATCTTCCTCGCCAACTCGGCAGTCCTCCTGGCCGCT
CACCTCCTCCCCCCGCAGCTCCGCCACCGGCTCCTCCAGTACGGTGCCCGCGGATCCGAGCCCCCGGTGGGCCAT
GACGCGCCCAGGCTGCTGTCCTTCATCGTCAACCTGCAGGTGCCGCACGCCTGGTTCTGGCACTTTTACCTTGAA
TCCCTTCTTTGGTCTCTTGTGTGGGCTTGGCAGTATCGAGGTCGGGGGACTTTGATGGGGGGGCTGGCCAGGGCG
CAGCTCGCTTCTTCGCATGTCTCGTCGGTTGACTTGGGGCGCGTTTGTCTGGCCTGGGCCATGTTCGCTGCTCAG
GGCTCTAGACGGCTGCTCGAATGCCTCTTTGTCATGCGGCCGGGCAAATCGTCCATGTCGTGGGCTCACTGGCTC
CTAGGTCTGGGTCATTACGCTCTCGTCAACCTGTCCATCTGGATACATGGCTCGGGTGGCATTCTCGAGTCCTGG
ACCGTATCGGTACCTGCTGTCCTGCTCACGCCGCGAAACTTGCTGTGCTTGACCGTCTTTCTGGCCGCCTGGCTC
GAACAAAACAAATGCCATCGTCATCTCGCCAGTCTTCCTAAATACACGCTTCCCACCGAGGGCTTGTTCCGTCTC
TTCGTCTGCCCTCACTACACGTGCGAGTGTGTCATGTATCTAGCGCTAGCCCTCGTTGCCGCCCCTCCCGACGGC
CTCTTCAACCCGAGCCTGCTCTGCGTCTTCGTCTTCGTCGTTACCAATCTCGGCATTACGGCTCGAAACTCGGAG
AAATGGTACGAGGAAAAATTCGGAAGAGATAAGCTGGCTGGCCGGTGGAAGATGATTCCTTTTGCCTTTTAG
Gene >Ophcf2|04497
ATGGCCATAACCCCATCGCCCGCCCTCTGCTGCCAGACCATCTTCCTCGCCAACTCGGCAGTCCTCCTGGCCGCT
CACCTCCTCCCCCCGCAGCTCCGCCACCGGCTCCTCCAGTACGGTGCCCGCGGATCCGAGCCCCCGGTGGGCCAT
GACGCGCCCAGGCTGCTGTCCTTCATCGTCAACCTGCAGGTGCCGCACGCCTGGTTCTGGCACTTTTACCTTGAA
TCCCTTCTTTGGTCTCTTGTGTGGGCTTGGCAGTATCGAGGTCGGGGGACTTTGATGGGGGGGCTGGCCAGGGCG
CAGCTCGCTTCTTCGCATGTCTCGTCGGTTGACTTGGGGCGCGTTTGTCTGGCCTGGGCCATGTTCGCTGCTCAG
GGCTCTAGACGGCTGCTCGAATGCCTCTTTGTCATGCGGCCGGGCAAATCGTCCATGTCGTGGGCTCACTGGCTC
CTAGGTCTGGGTCATTACGCTCTCGTCAACCTGTCCATCTGGATACATGGCTCGGGTCTGTTGACTTGCTTTGCC
CGCCATCTGTTGTGCCCGGAATCCCCACTAACAATCTTTACAAAAGGTGGCATTCTCGAGTCCTGGACCGTATCG
GTACCTGCTGTCCTGCTCACGCCGCGAAACTTGCTGTGCTTGACCGTCTTTCTGGCCGCCTGGCTCGAACAAAAC
AAATGCCATCGTCATCTCGCCAGTCTTCCTAAATACACGCTTCCCACCGAGGGCTTGTTCCGTCTCTTCGTCTGC
CCTCACTACACGTGCGAGTGTGTCATGTATCTAGCGCTAGCCCTCGTTGCCGCCCCTCCCGACGGCCTCTTCAAC
CCGAGCCTGCTCTGCGTCTTCGTCTTCGTCGTTACCAATCTCGGCATTACGGCTCGAAACTCGGAGAAATGGTAC
GAGGAAAAATTCGGAAGAGATAAGCTGGCTGGCCGGTGGAAGATGATTCCTTTTGCCTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail