Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04492
Gene name
Locationscaffold_04:3401347..3401823
Strand-
Gene length (bp)476
Transcript length (bp)390
Coding sequence length (bp)390
Protein length (aa) 130

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10262 Rdx Rdx family 1.7E-20 1 95

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5491 0.5386 0.1848 0.093 0.3073 0.0201 0.1875 0.1401 0.1372 0.0809

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3839
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1424
Ophiocordyceps australis map64 (Brazil) OphauB2|4088
Ophiocordyceps camponoti-floridani Ophcf2|04492 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7400
Ophiocordyceps kimflemingae Ophio5|1601
Ophiocordyceps subramaniannii Hirsu2|7555

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04492
MLRAAYYAQELLSTFNTTLSEVALQPSTGGTFVIAITYLDPDEPPQPQLETTGSTADTADDAATTTLKTKTSVLW
NRSVDGGFPETKELKRRVRDVIDPGRNLGHVDRHSRVQPEDDGPPCGDQQDCPT*
Coding >Ophcf2|04492
ATGCTCCGCGCCGCCTACTACGCCCAAGAACTCCTCTCAACATTCAACACCACACTGTCGGAAGTAGCCCTCCAG
CCCTCGACTGGCGGAACCTTCGTCATCGCCATCACTTACCTCGACCCCGACGAGCCTCCCCAGCCTCAACTAGAG
ACTACCGGCTCCACGGCCGACACCGCAGATGATGCCGCGACCACAACACTCAAAACTAAAACATCCGTCCTCTGG
AATCGCTCAGTCGACGGCGGCTTTCCCGAGACAAAAGAGCTCAAGCGCCGCGTCCGCGACGTCATCGACCCGGGC
CGTAACCTCGGTCACGTCGACCGCCACTCCCGGGTCCAGCCCGAGGACGACGGACCCCCCTGCGGCGATCAACAA
GACTGCCCGACCTGA
Transcript >Ophcf2|04492
ATGCTCCGCGCCGCCTACTACGCCCAAGAACTCCTCTCAACATTCAACACCACACTGTCGGAAGTAGCCCTCCAG
CCCTCGACTGGCGGAACCTTCGTCATCGCCATCACTTACCTCGACCCCGACGAGCCTCCCCAGCCTCAACTAGAG
ACTACCGGCTCCACGGCCGACACCGCAGATGATGCCGCGACCACAACACTCAAAACTAAAACATCCGTCCTCTGG
AATCGCTCAGTCGACGGCGGCTTTCCCGAGACAAAAGAGCTCAAGCGCCGCGTCCGCGACGTCATCGACCCGGGC
CGTAACCTCGGTCACGTCGACCGCCACTCCCGGGTCCAGCCCGAGGACGACGGACCCCCCTGCGGCGATCAACAA
GACTGCCCGACCTGA
Gene >Ophcf2|04492
ATGCTCCGCGCCGCCTACGTACGTACATACATACATACATACATACATATACGTCCTGTTTCCCCCCCCCCCCTC
CCTACAAGCAAATAACCACAACAACCCAGTACGCCCAAGAACTCCTCTCAACATTCAACACCACACTGTCGGAAG
TAGCCCTCCAGCCCTCGACTGGCGGAACCTTCGTCATCGCCATCACTTACCTCGACCCCGACGAGCCTCCCCAGC
CTCAACTAGAGACTACCGGCTCCACGGCCGACACCGCAGATGATGCCGCGACCACAACACTCAAAACTAAAACAT
CCGTCCTCTGGAATCGCTCAGTCGACGGCGGCTTTCCCGAGACAAAAGAGCTCAAGCGCCGCGTCCGCGACGTCA
TCGACCCGGGCCGTAACCTCGGTCACGTCGACCGCCACTCCCGGGTCCAGCCCGAGGACGACGGACCCCCCTGCG
GCGATCAACAAGACTGCCCGACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail