Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04489
Gene name
Locationscaffold_04:3388424..3391011
Strand+
Gene length (bp)2587
Transcript length (bp)2529
Coding sequence length (bp)2529
Protein length (aa) 843

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13855 LRR_8 Leucine rich repeat 1.2E-09 465 523

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6528 0.3155 0.1136 0.2243 0.0794 0.0025 0.1741 0.1812 0.2425 0.0123

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2487
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6227
Ophiocordyceps australis map64 (Brazil) OphauB2|4091
Ophiocordyceps camponoti-floridani Ophcf2|04489 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|972
Ophiocordyceps kimflemingae Ophio5|1598
Ophiocordyceps subramaniannii Hirsu2|3595

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04489
MSEDGEYFIKRLVAFVRTHEKSIANALQFQRREVRHRASQSTGSAASLSLSPSLPERPSTSSVSNSLAAALSFGS
INFTSHNAKSVRLALTPHHLFYLLSRFEELNIQVGPMKVRLEDLHDSSSTIYVSFLGNTGRSRSRSSDVGSIHSV
TSMRSVMSGMTALWTSFGIGASISAARTERHKAALHADLKYLYSAFTKIPCLRLAPDWRARLIKGYEEFPFDSAV
PLYVFKNLQALEIRSLDFRQFFGWDRLADQLRSLSLRRAGIEDPADVLIDIVLDDMDKRRRRSSKSQASPTATLA
ANGSPRRSPTIPHLGLVRAASAPGSPDARSALADLRVGSMTASDPAVEDTDASDAGRTPLARDEAEAPRHDRNHG
DHHHHHRHHQHHHQQHRSPTRPSRPRSNSPARPTSSRNHSHNVRSSQRIRRSGSGSSHSSMSDSWHHHSRGSTGN
LLAMGVLPSTKWRFLRHLSLADNALTSIPQASLAPLCNTLRSLDLSSNLFSQMPDSLASLTALRALNLSHCMIDS
LHSLTRSPLPAMTALNLRANRLRSLAGVEKLCSLERLDLRDNRLTDPRELARLTGMPDLREIWVEGNPLARTHKN
YRVTIFNLFRSTPGYTVDLVIDGRGPGYSERRHLVDRAPIPESVPVVKPKAPDAPVVVVDVGKAVPAEVSAGSTR
RRNKTSSKRRIVDLASGDISLPPLAVDTDVADRVQEATKVQVSEVSPSDGYRTSRPAESVLLPPVKLSPSGETGY
GGHRRADDVSSDLSAGADPQDWDVSGEIYRRRIQNLRDRVGSGYLSVLSEESWDGTGSFNGAGSTSVPPLRAGHL
SSNTLSAQAVHSGRTVG*
Coding >Ophcf2|04489
ATGAGTGAAGACGGAGAGTACTTCATCAAGCGCCTGGTGGCCTTTGTTCGCACCCACGAAAAGTCCATAGCCAAT
GCGCTCCAGTTCCAGCGCCGCGAGGTTCGTCATAGGGCCTCGCAGAGCACCGGCTCCGCCGCCTCGCTGTCCCTG
TCCCCCTCGCTGCCCGAGCGGCCCTCGACATCTTCCGTCTCGAATTCGCTCGCCGCCGCCTTGTCCTTTGGCTCC
ATCAACTTCACCTCTCATAATGCAAAGTCGGTGAGGCTGGCCTTGACCCCTCACCACCTCTTCTATCTCCTCTCC
CGCTTCGAGGAGCTCAACATCCAGGTTGGGCCCATGAAGGTCCGCCTCGAGGACCTCCACGACAGCTCCTCCACC
ATATACGTCTCCTTCCTCGGAAACACTGGCCGCTCCCGCTCCCGCAGCTCCGATGTCGGCTCCATCCACTCCGTC
ACCAGCATGCGAAGCGTCATGTCGGGCATGACGGCTCTCTGGACCAGCTTCGGCATCGGAGCCAGCATCTCCGCC
GCCAGGACCGAGCGCCACAAGGCCGCCCTCCACGCCGATCTCAAATACCTCTACTCGGCCTTCACCAAGATTCCC
TGCCTCCGCTTGGCCCCGGACTGGCGGGCCCGCCTGATTAAAGGCTACGAAGAGTTTCCCTTCGACTCGGCCGTG
CCGCTCTACGTCTTCAAAAACCTACAGGCCCTCGAGATCAGGAGCCTCGATTTTCGCCAGTTCTTTGGCTGGGAT
CGCCTGGCCGATCAGCTCCGCTCCCTCAGCCTGAGGCGCGCCGGCATCGAGGACCCGGCCGATGTCCTCATCGAC
ATTGTGCTCGATGACATGGACAAGCGGCGCCGGAGATCGTCCAAGTCCCAGGCCTCTCCCACGGCCACGCTCGCG
GCCAACGGCAGCCCGCGTCGGAGCCCCACGATACCCCATCTAGGCCTCGTCCGCGCCGCCTCGGCCCCCGGATCC
CCCGACGCCCGCAGCGCCCTCGCCGATCTCCGCGTCGGCTCCATGACGGCCAGCGACCCGGCTGTCGAGGACACG
GACGCGTCCGACGCCGGCAGGACTCCCCTCGCCCGCGACGAGGCTGAAGCCCCTCGCCATGACCGTAACCATGGC
GATCACCATCATCACCACCGACACCACCAACACCACCATCAACAACACCGCTCTCCCACCAGGCCGAGCCGTCCC
CGGAGTAACTCGCCCGCGCGACCAACCAGCTCGCGGAATCACTCCCACAACGTCCGCTCCTCTCAGCGCATCAGG
CGCTCGGGCTCTGGGAGCTCCCACTCCAGCATGTCCGACTCGTGGCATCACCACTCCAGGGGCAGCACGGGGAAC
CTCCTGGCCATGGGCGTCCTGCCCTCGACCAAATGGCGCTTCCTGCGTCACCTGAGCCTCGCCGACAACGCCCTG
ACGTCGATCCCGCAGGCCAGCCTCGCTCCCCTCTGCAACACGCTGCGCTCTCTCGACCTGTCCTCGAACCTGTTC
AGCCAGATGCCCGACAGCCTCGCGTCGCTGACTGCTCTCCGCGCCCTCAACCTCTCTCACTGCATGATCGACTCT
CTCCACTCCCTGACGCGCAGTCCGCTGCCGGCCATGACGGCCCTCAACCTGCGCGCCAACAGGCTCCGGTCGCTG
GCGGGCGTCGAGAAGCTCTGCTCGCTCGAGAGGCTGGATCTGCGCGACAACCGGCTGACGGATCCTCGTGAGTTG
GCCCGGCTGACGGGCATGCCCGACCTTCGCGAGATCTGGGTCGAGGGCAACCCCCTGGCCCGCACCCACAAGAAC
TACCGCGTCACCATATTCAACCTCTTCCGGTCGACGCCGGGCTATACCGTCGACCTCGTCATCGACGGCCGCGGG
CCCGGCTACTCCGAACGGCGGCACCTGGTGGATCGGGCGCCGATCCCGGAATCGGTCCCGGTGGTCAAGCCCAAG
GCCCCGGATGCCCCCGTCGTCGTCGTCGACGTCGGCAAGGCGGTACCGGCCGAGGTCAGCGCCGGCTCTACCCGA
CGTCGCAACAAGACGTCGAGCAAGAGACGCATCGTCGACCTGGCGAGTGGCGACATCTCTCTCCCCCCGCTGGCC
GTCGACACCGACGTCGCCGACAGGGTTCAGGAAGCGACCAAGGTGCAGGTCTCGGAAGTCTCTCCGTCGGACGGC
TACCGCACCTCGCGCCCCGCAGAGTCGGTGCTGCTGCCTCCGGTGAAGCTGTCGCCGAGCGGGGAGACGGGCTAC
GGAGGCCATCGGCGGGCGGACGACGTGAGCTCCGACTTGTCGGCCGGCGCGGACCCGCAAGATTGGGACGTCAGC
GGGGAGATTTACCGACGCAGGATCCAGAACCTGCGCGATCGTGTCGGCAGCGGATACCTCAGCGTCCTGAGCGAG
GAGAGCTGGGACGGGACTGGCAGCTTTAACGGGGCTGGGTCTACGTCTGTGCCGCCGCTTCGGGCTGGACATTTG
TCGAGTAACACGCTGTCTGCTCAGGCGGTTCACAGTGGCCGCACCGTGGGTTAG
Transcript >Ophcf2|04489
ATGAGTGAAGACGGAGAGTACTTCATCAAGCGCCTGGTGGCCTTTGTTCGCACCCACGAAAAGTCCATAGCCAAT
GCGCTCCAGTTCCAGCGCCGCGAGGTTCGTCATAGGGCCTCGCAGAGCACCGGCTCCGCCGCCTCGCTGTCCCTG
TCCCCCTCGCTGCCCGAGCGGCCCTCGACATCTTCCGTCTCGAATTCGCTCGCCGCCGCCTTGTCCTTTGGCTCC
ATCAACTTCACCTCTCATAATGCAAAGTCGGTGAGGCTGGCCTTGACCCCTCACCACCTCTTCTATCTCCTCTCC
CGCTTCGAGGAGCTCAACATCCAGGTTGGGCCCATGAAGGTCCGCCTCGAGGACCTCCACGACAGCTCCTCCACC
ATATACGTCTCCTTCCTCGGAAACACTGGCCGCTCCCGCTCCCGCAGCTCCGATGTCGGCTCCATCCACTCCGTC
ACCAGCATGCGAAGCGTCATGTCGGGCATGACGGCTCTCTGGACCAGCTTCGGCATCGGAGCCAGCATCTCCGCC
GCCAGGACCGAGCGCCACAAGGCCGCCCTCCACGCCGATCTCAAATACCTCTACTCGGCCTTCACCAAGATTCCC
TGCCTCCGCTTGGCCCCGGACTGGCGGGCCCGCCTGATTAAAGGCTACGAAGAGTTTCCCTTCGACTCGGCCGTG
CCGCTCTACGTCTTCAAAAACCTACAGGCCCTCGAGATCAGGAGCCTCGATTTTCGCCAGTTCTTTGGCTGGGAT
CGCCTGGCCGATCAGCTCCGCTCCCTCAGCCTGAGGCGCGCCGGCATCGAGGACCCGGCCGATGTCCTCATCGAC
ATTGTGCTCGATGACATGGACAAGCGGCGCCGGAGATCGTCCAAGTCCCAGGCCTCTCCCACGGCCACGCTCGCG
GCCAACGGCAGCCCGCGTCGGAGCCCCACGATACCCCATCTAGGCCTCGTCCGCGCCGCCTCGGCCCCCGGATCC
CCCGACGCCCGCAGCGCCCTCGCCGATCTCCGCGTCGGCTCCATGACGGCCAGCGACCCGGCTGTCGAGGACACG
GACGCGTCCGACGCCGGCAGGACTCCCCTCGCCCGCGACGAGGCTGAAGCCCCTCGCCATGACCGTAACCATGGC
GATCACCATCATCACCACCGACACCACCAACACCACCATCAACAACACCGCTCTCCCACCAGGCCGAGCCGTCCC
CGGAGTAACTCGCCCGCGCGACCAACCAGCTCGCGGAATCACTCCCACAACGTCCGCTCCTCTCAGCGCATCAGG
CGCTCGGGCTCTGGGAGCTCCCACTCCAGCATGTCCGACTCGTGGCATCACCACTCCAGGGGCAGCACGGGGAAC
CTCCTGGCCATGGGCGTCCTGCCCTCGACCAAATGGCGCTTCCTGCGTCACCTGAGCCTCGCCGACAACGCCCTG
ACGTCGATCCCGCAGGCCAGCCTCGCTCCCCTCTGCAACACGCTGCGCTCTCTCGACCTGTCCTCGAACCTGTTC
AGCCAGATGCCCGACAGCCTCGCGTCGCTGACTGCTCTCCGCGCCCTCAACCTCTCTCACTGCATGATCGACTCT
CTCCACTCCCTGACGCGCAGTCCGCTGCCGGCCATGACGGCCCTCAACCTGCGCGCCAACAGGCTCCGGTCGCTG
GCGGGCGTCGAGAAGCTCTGCTCGCTCGAGAGGCTGGATCTGCGCGACAACCGGCTGACGGATCCTCGTGAGTTG
GCCCGGCTGACGGGCATGCCCGACCTTCGCGAGATCTGGGTCGAGGGCAACCCCCTGGCCCGCACCCACAAGAAC
TACCGCGTCACCATATTCAACCTCTTCCGGTCGACGCCGGGCTATACCGTCGACCTCGTCATCGACGGCCGCGGG
CCCGGCTACTCCGAACGGCGGCACCTGGTGGATCGGGCGCCGATCCCGGAATCGGTCCCGGTGGTCAAGCCCAAG
GCCCCGGATGCCCCCGTCGTCGTCGTCGACGTCGGCAAGGCGGTACCGGCCGAGGTCAGCGCCGGCTCTACCCGA
CGTCGCAACAAGACGTCGAGCAAGAGACGCATCGTCGACCTGGCGAGTGGCGACATCTCTCTCCCCCCGCTGGCC
GTCGACACCGACGTCGCCGACAGGGTTCAGGAAGCGACCAAGGTGCAGGTCTCGGAAGTCTCTCCGTCGGACGGC
TACCGCACCTCGCGCCCCGCAGAGTCGGTGCTGCTGCCTCCGGTGAAGCTGTCGCCGAGCGGGGAGACGGGCTAC
GGAGGCCATCGGCGGGCGGACGACGTGAGCTCCGACTTGTCGGCCGGCGCGGACCCGCAAGATTGGGACGTCAGC
GGGGAGATTTACCGACGCAGGATCCAGAACCTGCGCGATCGTGTCGGCAGCGGATACCTCAGCGTCCTGAGCGAG
GAGAGCTGGGACGGGACTGGCAGCTTTAACGGGGCTGGGTCTACGTCTGTGCCGCCGCTTCGGGCTGGACATTTG
TCGAGTAACACGCTGTCTGCTCAGGCGGTTCACAGTGGCCGCACCGTGGGTTAG
Gene >Ophcf2|04489
ATGAGTGAAGACGGAGAGTACTTCATCAAGGTGCCACCGACGCGTCTTCCCTTGGCGACGACGCCTCGAAGCTGA
CTCCTCGAGATAGCGCCTGGTGGCCTTTGTTCGCACCCACGAAAAGTCCATAGCCAATGCGCTCCAGTTCCAGCG
CCGCGAGGTTCGTCATAGGGCCTCGCAGAGCACCGGCTCCGCCGCCTCGCTGTCCCTGTCCCCCTCGCTGCCCGA
GCGGCCCTCGACATCTTCCGTCTCGAATTCGCTCGCCGCCGCCTTGTCCTTTGGCTCCATCAACTTCACCTCTCA
TAATGCAAAGTCGGTGAGGCTGGCCTTGACCCCTCACCACCTCTTCTATCTCCTCTCCCGCTTCGAGGAGCTCAA
CATCCAGGTTGGGCCCATGAAGGTCCGCCTCGAGGACCTCCACGACAGCTCCTCCACCATATACGTCTCCTTCCT
CGGAAACACTGGCCGCTCCCGCTCCCGCAGCTCCGATGTCGGCTCCATCCACTCCGTCACCAGCATGCGAAGCGT
CATGTCGGGCATGACGGCTCTCTGGACCAGCTTCGGCATCGGAGCCAGCATCTCCGCCGCCAGGACCGAGCGCCA
CAAGGCCGCCCTCCACGCCGATCTCAAATACCTCTACTCGGCCTTCACCAAGATTCCCTGCCTCCGCTTGGCCCC
GGACTGGCGGGCCCGCCTGATTAAAGGCTACGAAGAGTTTCCCTTCGACTCGGCCGTGCCGCTCTACGTCTTCAA
AAACCTACAGGCCCTCGAGATCAGGAGCCTCGATTTTCGCCAGTTCTTTGGCTGGGATCGCCTGGCCGATCAGCT
CCGCTCCCTCAGCCTGAGGCGCGCCGGCATCGAGGACCCGGCCGATGTCCTCATCGACATTGTGCTCGATGACAT
GGACAAGCGGCGCCGGAGATCGTCCAAGTCCCAGGCCTCTCCCACGGCCACGCTCGCGGCCAACGGCAGCCCGCG
TCGGAGCCCCACGATACCCCATCTAGGCCTCGTCCGCGCCGCCTCGGCCCCCGGATCCCCCGACGCCCGCAGCGC
CCTCGCCGATCTCCGCGTCGGCTCCATGACGGCCAGCGACCCGGCTGTCGAGGACACGGACGCGTCCGACGCCGG
CAGGACTCCCCTCGCCCGCGACGAGGCTGAAGCCCCTCGCCATGACCGTAACCATGGCGATCACCATCATCACCA
CCGACACCACCAACACCACCATCAACAACACCGCTCTCCCACCAGGCCGAGCCGTCCCCGGAGTAACTCGCCCGC
GCGACCAACCAGCTCGCGGAATCACTCCCACAACGTCCGCTCCTCTCAGCGCATCAGGCGCTCGGGCTCTGGGAG
CTCCCACTCCAGCATGTCCGACTCGTGGCATCACCACTCCAGGGGCAGCACGGGGAACCTCCTGGCCATGGGCGT
CCTGCCCTCGACCAAATGGCGCTTCCTGCGTCACCTGAGCCTCGCCGACAACGCCCTGACGTCGATCCCGCAGGC
CAGCCTCGCTCCCCTCTGCAACACGCTGCGCTCTCTCGACCTGTCCTCGAACCTGTTCAGCCAGATGCCCGACAG
CCTCGCGTCGCTGACTGCTCTCCGCGCCCTCAACCTCTCTCACTGCATGATCGACTCTCTCCACTCCCTGACGCG
CAGTCCGCTGCCGGCCATGACGGCCCTCAACCTGCGCGCCAACAGGCTCCGGTCGCTGGCGGGCGTCGAGAAGCT
CTGCTCGCTCGAGAGGCTGGATCTGCGCGACAACCGGCTGACGGATCCTCGTGAGTTGGCCCGGCTGACGGGCAT
GCCCGACCTTCGCGAGATCTGGGTCGAGGGCAACCCCCTGGCCCGCACCCACAAGAACTACCGCGTCACCATATT
CAACCTCTTCCGGTCGACGCCGGGCTATACCGTCGACCTCGTCATCGACGGCCGCGGGCCCGGCTACTCCGAACG
GCGGCACCTGGTGGATCGGGCGCCGATCCCGGAATCGGTCCCGGTGGTCAAGCCCAAGGCCCCGGATGCCCCCGT
CGTCGTCGTCGACGTCGGCAAGGCGGTACCGGCCGAGGTCAGCGCCGGCTCTACCCGACGTCGCAACAAGACGTC
GAGCAAGAGACGCATCGTCGACCTGGCGAGTGGCGACATCTCTCTCCCCCCGCTGGCCGTCGACACCGACGTCGC
CGACAGGGTTCAGGAAGCGACCAAGGTGCAGGTCTCGGAAGTCTCTCCGTCGGACGGCTACCGCACCTCGCGCCC
CGCAGAGTCGGTGCTGCTGCCTCCGGTGAAGCTGTCGCCGAGCGGGGAGACGGGCTACGGAGGCCATCGGCGGGC
GGACGACGTGAGCTCCGACTTGTCGGCCGGCGCGGACCCGCAAGATTGGGACGTCAGCGGGGAGATTTACCGACG
CAGGATCCAGAACCTGCGCGATCGTGTCGGCAGCGGATACCTCAGCGTCCTGAGCGAGGAGAGCTGGGACGGGAC
TGGCAGCTTTAACGGGGCTGGGTCTACGTCTGTGCCGCCGCTTCGGGCTGGACATTTGTCGAGTAACACGCTGTC
TGCTCAGGCGGTTCACAGTGGCCGCACCGTGGGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail