Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04486
Gene name
Locationscaffold_04:3377335..3380336
Strand+
Gene length (bp)3001
Transcript length (bp)2532
Coding sequence length (bp)2532
Protein length (aa) 844

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.8E-174 142 801

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:1904680 peptide transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 250 269 19
2 276 298 22
3 330 352 22
4 404 426 22
5 470 492 22
6 522 544 22
7 548 570 22
8 596 618 22
9 633 655 22
10 703 722 19
11 737 759 22
12 780 802 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04486
MFEEFTYFLSWLDGFQARSTFLKTSYIYTDLIDPRLYGMASAAEATGVEGRGPQLSHRRSVSLDSLDGLDGLDGL
DGLNPERENAPLMLDDEEYELRNWQPRVEGAHDKAVDEEGDDEEEEEDSPYAEVRAAIGNRDEDVSCSTIRAWVI
GLLLVLVGASTNTLFSLRQPSISVGALVGQILAWPLGHGWARLFPDWQVPTPFGRSLPLNPGPFTIKEHSIIGVM
ASVSFSVAYSTDIILAQMVFYKQDFGILFQILLTISTQSLGYGIAGAMRKYLVYPASMIWPGILVSVTMMNVMYE
KEDDDKDGSSSSFGGSIPRYRWFGLVTAGAFVYYFIPGFLVQCLSVFAFATWMAPQNVVINQLFGGTTGLSLVPL
TLDWTQIAGWVGSPLIPPWYAIVNVTIGVSVFYVFGCSVLHYSGAWYAPFLPMSDASTYDNTGKPYNTSRVLKPD
FTLDEDAYRAYSPLFISTSFAMAYGLAFAAISSLIVHTFLHYRKQIWKQYRNSTGEKPDIHMKLMSRYSEAPMWW
YLTLFVAMLALGLYTVLAYPTQLSWWAYLLAVGISYGFSLPIGIIEAVTSSQIGLNVLTEFIYGYIQPGRPLALM
IFKTFGSITMGQALRFVADLKFGHYMKIPPKTMFFAQVIATTLSSVVQIATLNLALGSIEDVCDIHQRDRFTCPG
GRVFFSASVIWGLIGPDRIFSPGRIYQGLFLFFVLGAVTPIAIHFASKRYPSSPVKYLMAPLIFGGAGAIPPATP
LNYFSWAMVGFIFQYYIKRRHFRWWSRLNFLTSCGLDLGLALGTLFIFFAFSMHGIKPPRWWPNTVVSTTMDVQG
TAVQVRVDEGQRFGPDVW*
Coding >Ophcf2|04486
ATGTTCGAGGAGTTCACATACTTCTTGTCATGGCTTGACGGGTTCCAGGCGCGTTCCACTTTTCTCAAGACTTCC
TACATCTATACGGATCTTATCGACCCTCGTCTATACGGTATGGCGTCGGCGGCCGAAGCGACGGGCGTCGAGGGC
AGAGGTCCCCAGCTGTCTCATCGACGGTCCGTGTCCCTCGACAGCCTCGATGGGCTCGACGGCCTCGACGGCCTC
GACGGTCTCAACCCGGAGCGGGAGAACGCACCGCTCATGTTGGATGACGAGGAGTACGAGCTCCGAAACTGGCAG
CCACGCGTCGAGGGCGCACACGACAAGGCAGTGGACGAAGAGGGTGATGACGAAGAAGAGGAAGAGGATTCGCCA
TATGCCGAGGTCCGTGCCGCCATTGGGAACCGCGACGAGGATGTTTCCTGCAGCACGATCCGCGCCTGGGTCATT
GGCCTGCTCCTCGTCCTCGTCGGCGCCTCGACCAATACGCTCTTCTCGCTGCGACAGCCGTCCATCTCGGTGGGC
GCACTGGTGGGCCAGATCCTGGCTTGGCCGCTGGGTCACGGCTGGGCACGTCTCTTCCCGGACTGGCAGGTGCCC
ACTCCATTCGGACGCAGTCTGCCGTTGAATCCGGGGCCTTTTACCATCAAAGAGCACAGCATCATTGGCGTCATG
GCCAGCGTTTCGTTTTCGGTCGCCTATTCGACCGATATCATACTGGCGCAGATGGTGTTTTACAAGCAGGATTTC
GGCATTCTCTTCCAGATTCTATTGACCATCTCGACGCAGTCGCTCGGCTACGGCATTGCCGGTGCCATGCGCAAG
TATCTCGTCTATCCGGCCTCCATGATCTGGCCCGGCATCCTAGTTTCTGTGACGATGATGAACGTCATGTACGAG
AAGGAGGACGATGACAAGGACGGATCCTCGTCCTCCTTCGGCGGTTCTATACCTCGCTACCGCTGGTTTGGACTG
GTGACGGCCGGCGCCTTCGTCTACTACTTCATCCCCGGGTTCCTGGTTCAGTGCCTCAGCGTCTTCGCCTTTGCC
ACCTGGATGGCGCCGCAGAACGTCGTCATCAACCAGCTGTTTGGCGGCACGACGGGCCTGTCGCTGGTGCCGCTC
ACGCTGGACTGGACCCAGATCGCCGGTTGGGTCGGGTCGCCGCTGATCCCGCCATGGTATGCCATCGTCAACGTC
ACCATCGGCGTCTCCGTCTTCTACGTCTTTGGCTGCTCCGTGCTGCACTACTCGGGCGCCTGGTACGCACCCTTC
CTGCCCATGAGCGACGCCTCAACGTACGACAACACGGGGAAGCCCTACAACACGTCGCGGGTCCTGAAGCCCGAC
TTTACGCTCGACGAAGACGCCTACCGCGCGTACTCGCCGCTGTTCATAAGCACGTCGTTCGCCATGGCCTACGGC
TTGGCCTTTGCCGCCATATCGTCGCTAATCGTTCACACTTTTTTGCACTATCGCAAGCAGATCTGGAAGCAGTAC
CGCAACAGCACGGGCGAGAAGCCGGATATCCACATGAAGCTCATGAGCCGATATAGCGAGGCGCCCATGTGGTGG
TACCTGACGCTCTTCGTCGCCATGCTCGCCCTTGGTCTCTACACCGTGCTGGCTTATCCCACTCAGCTATCGTGG
TGGGCGTATCTGCTCGCCGTCGGCATATCGTACGGCTTCTCGCTGCCGATTGGCATCATCGAGGCTGTGACGAGC
AGCCAGATCGGGCTCAACGTCCTGACCGAGTTCATCTACGGGTACATCCAGCCGGGCCGGCCTCTGGCTCTTATG
ATCTTCAAGACGTTTGGAAGCATCACCATGGGACAGGCCCTCCGCTTCGTCGCGGACCTCAAGTTCGGCCACTAC
ATGAAGATCCCGCCCAAGACCATGTTCTTCGCCCAGGTCATCGCCACCACGCTCTCGTCTGTCGTCCAGATCGCG
ACGCTCAATCTGGCTCTCGGCAGCATCGAAGACGTCTGCGACATCCATCAGCGCGATCGCTTCACCTGCCCCGGT
GGCCGCGTCTTCTTCTCCGCGTCCGTCATCTGGGGCCTCATCGGTCCGGACCGCATCTTCTCCCCCGGGCGCATC
TACCAGGGTCTCTTCCTGTTCTTCGTGCTCGGCGCCGTCACCCCCATCGCCATTCACTTCGCATCCAAGCGATAC
CCGTCATCGCCGGTCAAGTATCTGATGGCGCCTCTCATCTTCGGCGGCGCCGGCGCCATCCCTCCCGCCACGCCG
CTCAACTACTTCTCCTGGGCGATGGTGGGCTTCATCTTCCAGTATTACATCAAGAGGCGTCACTTCCGCTGGTGG
AGCCGCCTCAACTTCCTCACCTCGTGCGGTCTCGATCTCGGCCTCGCCCTCGGCACCCTCTTCATTTTCTTCGCC
TTCTCTATGCATGGCATAAAGCCGCCCCGCTGGTGGCCCAACACCGTCGTGTCCACCACCATGGACGTTCAGGGG
ACGGCTGTTCAGGTCCGCGTCGACGAGGGGCAGCGCTTCGGCCCCGATGTGTGGTAG
Transcript >Ophcf2|04486
ATGTTCGAGGAGTTCACATACTTCTTGTCATGGCTTGACGGGTTCCAGGCGCGTTCCACTTTTCTCAAGACTTCC
TACATCTATACGGATCTTATCGACCCTCGTCTATACGGTATGGCGTCGGCGGCCGAAGCGACGGGCGTCGAGGGC
AGAGGTCCCCAGCTGTCTCATCGACGGTCCGTGTCCCTCGACAGCCTCGATGGGCTCGACGGCCTCGACGGCCTC
GACGGTCTCAACCCGGAGCGGGAGAACGCACCGCTCATGTTGGATGACGAGGAGTACGAGCTCCGAAACTGGCAG
CCACGCGTCGAGGGCGCACACGACAAGGCAGTGGACGAAGAGGGTGATGACGAAGAAGAGGAAGAGGATTCGCCA
TATGCCGAGGTCCGTGCCGCCATTGGGAACCGCGACGAGGATGTTTCCTGCAGCACGATCCGCGCCTGGGTCATT
GGCCTGCTCCTCGTCCTCGTCGGCGCCTCGACCAATACGCTCTTCTCGCTGCGACAGCCGTCCATCTCGGTGGGC
GCACTGGTGGGCCAGATCCTGGCTTGGCCGCTGGGTCACGGCTGGGCACGTCTCTTCCCGGACTGGCAGGTGCCC
ACTCCATTCGGACGCAGTCTGCCGTTGAATCCGGGGCCTTTTACCATCAAAGAGCACAGCATCATTGGCGTCATG
GCCAGCGTTTCGTTTTCGGTCGCCTATTCGACCGATATCATACTGGCGCAGATGGTGTTTTACAAGCAGGATTTC
GGCATTCTCTTCCAGATTCTATTGACCATCTCGACGCAGTCGCTCGGCTACGGCATTGCCGGTGCCATGCGCAAG
TATCTCGTCTATCCGGCCTCCATGATCTGGCCCGGCATCCTAGTTTCTGTGACGATGATGAACGTCATGTACGAG
AAGGAGGACGATGACAAGGACGGATCCTCGTCCTCCTTCGGCGGTTCTATACCTCGCTACCGCTGGTTTGGACTG
GTGACGGCCGGCGCCTTCGTCTACTACTTCATCCCCGGGTTCCTGGTTCAGTGCCTCAGCGTCTTCGCCTTTGCC
ACCTGGATGGCGCCGCAGAACGTCGTCATCAACCAGCTGTTTGGCGGCACGACGGGCCTGTCGCTGGTGCCGCTC
ACGCTGGACTGGACCCAGATCGCCGGTTGGGTCGGGTCGCCGCTGATCCCGCCATGGTATGCCATCGTCAACGTC
ACCATCGGCGTCTCCGTCTTCTACGTCTTTGGCTGCTCCGTGCTGCACTACTCGGGCGCCTGGTACGCACCCTTC
CTGCCCATGAGCGACGCCTCAACGTACGACAACACGGGGAAGCCCTACAACACGTCGCGGGTCCTGAAGCCCGAC
TTTACGCTCGACGAAGACGCCTACCGCGCGTACTCGCCGCTGTTCATAAGCACGTCGTTCGCCATGGCCTACGGC
TTGGCCTTTGCCGCCATATCGTCGCTAATCGTTCACACTTTTTTGCACTATCGCAAGCAGATCTGGAAGCAGTAC
CGCAACAGCACGGGCGAGAAGCCGGATATCCACATGAAGCTCATGAGCCGATATAGCGAGGCGCCCATGTGGTGG
TACCTGACGCTCTTCGTCGCCATGCTCGCCCTTGGTCTCTACACCGTGCTGGCTTATCCCACTCAGCTATCGTGG
TGGGCGTATCTGCTCGCCGTCGGCATATCGTACGGCTTCTCGCTGCCGATTGGCATCATCGAGGCTGTGACGAGC
AGCCAGATCGGGCTCAACGTCCTGACCGAGTTCATCTACGGGTACATCCAGCCGGGCCGGCCTCTGGCTCTTATG
ATCTTCAAGACGTTTGGAAGCATCACCATGGGACAGGCCCTCCGCTTCGTCGCGGACCTCAAGTTCGGCCACTAC
ATGAAGATCCCGCCCAAGACCATGTTCTTCGCCCAGGTCATCGCCACCACGCTCTCGTCTGTCGTCCAGATCGCG
ACGCTCAATCTGGCTCTCGGCAGCATCGAAGACGTCTGCGACATCCATCAGCGCGATCGCTTCACCTGCCCCGGT
GGCCGCGTCTTCTTCTCCGCGTCCGTCATCTGGGGCCTCATCGGTCCGGACCGCATCTTCTCCCCCGGGCGCATC
TACCAGGGTCTCTTCCTGTTCTTCGTGCTCGGCGCCGTCACCCCCATCGCCATTCACTTCGCATCCAAGCGATAC
CCGTCATCGCCGGTCAAGTATCTGATGGCGCCTCTCATCTTCGGCGGCGCCGGCGCCATCCCTCCCGCCACGCCG
CTCAACTACTTCTCCTGGGCGATGGTGGGCTTCATCTTCCAGTATTACATCAAGAGGCGTCACTTCCGCTGGTGG
AGCCGCCTCAACTTCCTCACCTCGTGCGGTCTCGATCTCGGCCTCGCCCTCGGCACCCTCTTCATTTTCTTCGCC
TTCTCTATGCATGGCATAAAGCCGCCCCGCTGGTGGCCCAACACCGTCGTGTCCACCACCATGGACGTTCAGGGG
ACGGCTGTTCAGGTCCGCGTCGACGAGGGGCAGCGCTTCGGCCCCGATGTGTGGTAG
Gene >Ophcf2|04486
ATGTTCGAGGAGTTCACATACTTCTTGTCATGGCTTGACGGGTTGGCCGATTTGGAACGTGAGCCGTGACGGAGA
TTCGACTTTGTTTAGGTTCCAGGCGCGTTCCACTTTTCTCAAGACTTCCTACATCTGTTTGTCTCTTATCTGCTA
CCGTCAAGCTGCTTTTCCTGATGGTCGATTGATAGATACGGATCTTATCGACCCTCGTCTATACGGTATGGCGTC
GGCGGCCGAAGCGACGGGCGTCGAGGGCAGAGGTCCCCAGCTGTCTCATCGACGGTCCGTGTCCCTCGACAGCCT
CGATGGGCTCGACGGCCTCGACGGCCTCGACGGTCTCAACCCGGAGCGGGAGAACGCACCGCTCATGTTGGATGA
CGAGGAGTACGAGCTCCGAAACTGGCAGCCACGCGTCGAGGGCGCACACGACAAGGCAGTGGACGAAGAGGGTGA
TGACGAAGAAGAGGAAGAGGATTCGCCATATGCCGAGGTCCGTGCCGCCATTGGGAACCGCGACGAGGATGTTTC
CTGCAGCACGATCCGCGCCTGGGTCATTGGCCTGCTCCTCGTCCTCGTCGGCGCCTCGACCAATACGCTCTTCTC
GCTGCGACAGCCGTCCATCTCGGTGGGCGCACTGGTGGGCCAGATCCTGGCTTGGCCGCTGGGTCACGGCTGGGC
ACGTCTCTTCCCGGACTGGCAGGTGCCCACTCCATTCGGACGCAGTCTGCCGTTGAATCCGGGGCCTTTTACCAT
CAAAGAGCACAGCATCATTGGCGTCATGGCCAGCGTTTCGTTTTCGGTCGCCTATTCGACCGATATCATACTGGC
GCAGATGGTGTTTTACAAGCAGGATTTCGGCATTCTCTTCCAGATTCTATTGACCATCTCGACGCAGTCGCTCGG
CTACGGCATTGCCGGTGCCATGCGCAAGTATCTCGGTGGGTTCCGCCCTCCTGTGACGGTTGGGTGGGCTCTCGT
CCTCTCCTTGACCGACTAACTCCGGCTCCGGGGATAGTCTATCCGGCCTCCATGATCTGGCCCGGCATCCTAGTT
TCTGTGACGATGATGAACGTCATGTACGAGAAGGAGGACGATGACAAGGACGGATCCTCGTCCTCCTTCGGCGGT
TCTATACCTCGCTACCGCTGGTTTGGACTGGTGACGGCCGGCGCCTTCGTCTACTACTTCATCCCCGGGTTCCTG
GTTCAGTGCCTCAGCGTCTTCGCCTTTGCCACCTGGATGGCGCCGCAGAACGTCGTCATCAACCAGCTGTTTGGC
GGCACGACGGGCCTGTCGCTGGTGCCGCTCACGCTGGACTGGACCCAGATCGCCGGTTGGGTCGGGTCGCCGCTG
ATCCCGCCATGGTATTATCTTAGCGATCCTCCTCGACAGCAGCAGATGGACGTCTTTCTCATGGGCTCTATAGGT
ATGCCATCGTCAACGTCACCATCGGCGTCTCCGTCTTCTACGTCTTTGGCTGCTCCGTGCTGCACTACTCGGGCG
CCTGGTACGCACCCTTCCTGCCCATGAGCGACGCCTCAACGTACGACAACACGGGGAAGCCCTACAACACGTCGC
GGGTCCTGAAGCCCGACTTTACGCTCGACGAAGACGCCTACCGCGCGTACTCGCCGCTGTTCATAAGCACGTCGT
TCGCCATGGCCTACGGCTTGGCCTTTGCCGCCATATCGTCGCTAATCGTTCACACTTTTTTGCACTATCGCAAGC
AGATCTGGAAGCAGTACCGCAACAGCACGGGCGAGAAGCCGGATATCCACATGAAGCTCATGAGCCGATATAGCG
AGGCGCCCATGTGGTGGTACCTGACGCTCTTCGTCGCCGTTCGTATCATGTCGTTCCTCCCCTTCCCCTGACGAC
TCTGTGACTCACACGGAGGCCAGATGCTCGCCCTTGGTCTCTACACCGTGCTGGCTTATCCCACTCAGCTATCGT
GGTGGGCGTATCTGCTCGCCGTCGGCATATCGTACGGCTTCTCGCTGCCGATTGGCATCATCGAGGCTGTGACGA
GCAGCCAGATCGGGCTCAACGTCCTGACCGAGTTCATCTACGGGTACATCCAGCCGGGCCGGCCTCTGGCTCTTA
TGATGTACGACTCCGTCTTTGCACTCTTGCTGTCTATAGCTGACCAACGGACAGCTTCAAGACGTTTGGAAGCAT
CACCATGTGCGCCCCCCGCAATGGTCCCTTGTGAATGCTTCCCCTCTGACGCATCCTTCAGGGGACAGGCCCTCC
GCTTCGTCGCGGACCTCAAGTTCGGCCACTACATGAAGATCCCGCCCAAGACCATGTTCTTCGCCCAGGTCATCG
CCACCACGCTCTCGTCTGTCGTCCAGATCGCGACGCTCAATCTGGCTCTCGGCAGCATCGAAGACGTCTGCGACA
TCCATCAGCGCGATCGCTTCACCTGCCCCGGTGGCCGCGTCTTCTTCTCCGGTGAGTTCTCTCATCGACCTCACA
TCAGCTTCCCATGCCTCGTCTGACTCTCCCCTACGAAGCGTCCGTCATCTGGGGCCTCATCGGTCCGGACCGCAT
CTTCTCCCCCGGGCGCATCTACCAGGGTCTCTTCCTGTTCTTCGTGCTCGGCGCCGTCACCCCCATCGCCATTCA
CTTCGCATCCAAGCGATACCCGTCATCGCCGGTCAAGTATCTGATGGCGCCTCTCATCTTCGGCGGCGCCGGCGC
CATCCCTCCCGCCACGCCGCTCAACTACTTCTCCTGGGCGATGGTGGGCTTCATCTTCCAGTATTACATCAAGAG
GCGTCACTTCCGCTGGTGGAGCCGCCTCAACTTCCTCACCTCGTGCGGTCTCGATCTCGGCCTCGCCCTCGGCAC
CCTCTTCATTTTCTTCGCCTTCTCTATGCATGGCATAAAGCCGCCCCGCTGGTGGCCCAACACCGTCGTGTCCAC
CACCATGGACGTTCAGGGGACGGCTGTTCAGGTCCGCGTCGACGAGGGGCAGCGCTTCGGCCCCGATGTGTGGTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail