Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04484
Gene name
Locationscaffold_04:3374081..3375027
Strand-
Gene length (bp)946
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03981 Ubiq_cyt_C_chap Ubiquinol-cytochrome C chaperone 1.8E-30 116 253

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1337 0.1526 0.0318 0.0394 0.939 0.0907 0.0569 0.0372 0.0567 0.0101

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4913
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1475
Ophiocordyceps australis map64 (Brazil) OphauB2|4096
Ophiocordyceps camponoti-floridani Ophcf2|04484 (this protein)
Ophiocordyceps kimflemingae Ophio5|1591
Ophiocordyceps subramaniannii Hirsu2|1472

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04484
MACERLKWQLRSLVQLTARARPRPSSPSTSNTPLPRRSPTSQTRRVSGTAQRWGLLSSYTEAYRVIAASERVFKV
CSKPADYAISDKVRKEDGVKKLEDGEELGVPLTPLNVWHSTFKLPPSFNTWSHVTMLHLYLINAQLRCFENDAYR
SWQQQLIDHFFFECEKKMHLDHNITSSALRQRYLKDVFVQWRGLLLAYDEGLIRGDAILASAVWRNLFKGSPDVE
PMALLAVVGWMRASLVALEGVSEQSLAQDVQGILTKHVASFATELMKAKEKLRPIEERCIYIPKS*
Coding >Ophcf2|04484
ATGGCCTGCGAGAGACTCAAGTGGCAGCTCCGAAGCCTCGTCCAGCTCACCGCCCGCGCGAGGCCAAGGCCATCA
TCGCCCTCGACGAGCAACACGCCTCTTCCCCGGCGCAGCCCGACCTCCCAGACCCGGCGGGTGAGCGGTACGGCG
CAGAGATGGGGCCTGTTGAGCTCTTACACGGAGGCTTACCGCGTCATCGCCGCCTCGGAACGCGTCTTCAAGGTG
TGCTCCAAACCGGCTGACTACGCCATTTCCGACAAGGTCCGCAAGGAAGATGGTGTCAAGAAGCTGGAGGATGGA
GAGGAGCTTGGCGTTCCTCTCACGCCGCTCAACGTGTGGCACAGCACTTTTAAGCTGCCACCGAGCTTCAATACC
TGGTCGCACGTCACGATGCTGCACTTGTATCTTATCAACGCGCAGCTGCGATGCTTCGAAAACGACGCCTATCGG
AGCTGGCAGCAACAGCTGATCGACCATTTCTTCTTCGAGTGCGAGAAGAAGATGCATCTGGATCACAACATTACG
TCGAGCGCGCTGCGCCAACGATACCTCAAGGACGTCTTCGTCCAGTGGCGCGGGCTGCTGCTGGCGTACGATGAG
GGACTCATCAGGGGTGACGCCATCCTCGCCAGTGCCGTGTGGCGGAACCTGTTCAAAGGGTCGCCCGACGTTGAG
CCAATGGCGCTGCTGGCCGTCGTTGGCTGGATGAGGGCGTCGTTGGTTGCGCTAGAGGGCGTGTCTGAGCAATCG
CTGGCGCAGGACGTGCAGGGCATATTGACAAAGCACGTCGCTTCCTTCGCCACCGAACTGATGAAAGCCAAGGAG
AAACTGCGGCCCATCGAAGAGCGGTGTATCTACATTCCAAAGTCTTGA
Transcript >Ophcf2|04484
ATGGCCTGCGAGAGACTCAAGTGGCAGCTCCGAAGCCTCGTCCAGCTCACCGCCCGCGCGAGGCCAAGGCCATCA
TCGCCCTCGACGAGCAACACGCCTCTTCCCCGGCGCAGCCCGACCTCCCAGACCCGGCGGGTGAGCGGTACGGCG
CAGAGATGGGGCCTGTTGAGCTCTTACACGGAGGCTTACCGCGTCATCGCCGCCTCGGAACGCGTCTTCAAGGTG
TGCTCCAAACCGGCTGACTACGCCATTTCCGACAAGGTCCGCAAGGAAGATGGTGTCAAGAAGCTGGAGGATGGA
GAGGAGCTTGGCGTTCCTCTCACGCCGCTCAACGTGTGGCACAGCACTTTTAAGCTGCCACCGAGCTTCAATACC
TGGTCGCACGTCACGATGCTGCACTTGTATCTTATCAACGCGCAGCTGCGATGCTTCGAAAACGACGCCTATCGG
AGCTGGCAGCAACAGCTGATCGACCATTTCTTCTTCGAGTGCGAGAAGAAGATGCATCTGGATCACAACATTACG
TCGAGCGCGCTGCGCCAACGATACCTCAAGGACGTCTTCGTCCAGTGGCGCGGGCTGCTGCTGGCGTACGATGAG
GGACTCATCAGGGGTGACGCCATCCTCGCCAGTGCCGTGTGGCGGAACCTGTTCAAAGGGTCGCCCGACGTTGAG
CCAATGGCGCTGCTGGCCGTCGTTGGCTGGATGAGGGCGTCGTTGGTTGCGCTAGAGGGCGTGTCTGAGCAATCG
CTGGCGCAGGACGTGCAGGGCATATTGACAAAGCACGTCGCTTCCTTCGCCACCGAACTGATGAAAGCCAAGGAG
AAACTGCGGCCCATCGAAGAGCGGTGTATCTACATTCCAAAGTCTTGA
Gene >Ophcf2|04484
ATGGCCTGCGAGAGACTCAAGTGGCAGCTCCGAAGCCTCGTCCAGCTCACCGCCCGCGCGAGGCCAAGGCCATCA
TCGCCCTCGACGAGCAACACGCCTCTTCCCCGGCGCAGCCCGACCTCCCAGACCCGGCGGGTGAGCGGTACGGCG
CAGAGATGGGGCCTGTTGAGCTCTTACACGGAGGCTTACCGCGTCATCGCCGCCTCGGAACGCGTCTTCAAGGTG
TGCTCCAAACCGGCTGACTACGCCATTTCCGACAAGGTCCGCAAGGAAGATGGTGTCAAGAAGCTGGAGGATGGA
GAGGAGCTTGGCGTTCCTCTCACGCCGCTCAACGTGTGGCACAGCAGTGCGTTGTTTGCGTCCTTTCGCCGCGGT
TCGATGGAGGGCGTTGGGCTAACCTTTTTTTCCCTCCGTGTCAGCTTTTAAGCTGCCACCGAGCTTCAATACCTG
GTCGCACGTCACGATGCTGCACTTGTATCTTATCAACGCGCAGCTGCGATGCTTCGAAAACGACGCCTATCGGAG
CTGGCAGCAACAGCTGATCGACCATTTCTTCTTCGAGTGCGAGAAGAAGATGCATCTGGATCACAACATTACGTC
GAGCGCGCTGCGCCAACGATACCTCAAGGACGTCTTCGTCCAGTGGCGCGGGCTGCTGCTGGCGTACGATGAGGG
ACTCATCAGGGGTGACGCCATCCTCGCCAGTGCCGTGTGGCGGAACCTGTTCAAAGGGTCGCCCGACGTTGAGCC
AATGGCGCTGCTGGCCGTCGTTGGCTGGATGAGGGCGTCGTTGGTTGCGCTAGAGGGCGTGTCTGAGCAATCGCT
GGCGCAGGACGTGCAGGGCATATTGACAAAGCACGTCGCTTCCTTCGCCACCGAACTGATGAAAGCCAAGGAGAA
ACTGCGGCCCATCGAAGAGCGGTGTATCTACATTCCAAAGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail