Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04483
Gene name
Locationscaffold_04:3373133..3373811
Strand+
Gene length (bp)678
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00186 DHFR_1 Dihydrofolate reductase 1.3E-26 6 159

GO

GO Term Description Terminal node
GO:0046654 tetrahydrofolate biosynthetic process Yes
GO:0004146 dihydrofolate reductase activity Yes
GO:0008152 metabolic process No
GO:0016645 oxidoreductase activity, acting on the CH-NH group of donors No
GO:0018130 heterocycle biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0016491 oxidoreductase activity No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0042558 pteridine-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006760 folic acid-containing compound metabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0042398 cellular modified amino acid biosynthetic process No
GO:0003674 molecular_function No
GO:0046653 tetrahydrofolate metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0009396 folic acid-containing compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0042559 pteridine-containing compound biosynthetic process No
GO:0016646 oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus|Mitochondrion Mitochondrial transit peptide|Nuclear localization signal 0.6669 0.6009 0.0335 0.0448 0.7722 0.0951 0.0988 0.2287 0.1056 0.1702

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup502
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1476
Ophiocordyceps australis map64 (Brazil) OphauB2|4097
Ophiocordyceps camponoti-floridani Ophcf2|04483 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|967
Ophiocordyceps kimflemingae Ophio5|1590
Ophiocordyceps subramaniannii Hirsu2|1473

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04483
MQPPELTLIVAATRSMGIGAQGSLPWTGLRRELQYFARVTTRSPPQAPPGAINGVIMGRNTWDSIPPKFRPLKNR
LNIVLTRSAPSLDDGDVPTPDPLQPLRVPSFDDALRYAARHCPRVFVIGGAQVYDAALRSSSARRVLLTLVERDF
ECDTFFPITLPGATGWARRSSDELRRWTGEDADSVHHEENGIKYEFQMWEVSQ*
Coding >Ophcf2|04483
ATGCAACCTCCCGAGCTGACACTCATCGTCGCAGCAACCCGCTCCATGGGAATCGGTGCCCAAGGTTCCCTCCCC
TGGACCGGCCTGCGCAGGGAGCTACAATACTTTGCCCGCGTAACCACCCGGTCACCGCCACAGGCACCCCCCGGA
GCCATCAACGGCGTCATAATGGGCCGAAACACATGGGATTCCATCCCGCCCAAGTTCCGCCCGCTCAAGAACCGT
CTCAACATCGTCCTCACCCGTTCCGCCCCTTCGCTGGACGACGGCGATGTCCCGACGCCCGATCCGCTTCAGCCC
CTGCGCGTGCCCTCGTTCGACGATGCCCTCCGCTACGCAGCCCGTCACTGCCCCCGCGTCTTCGTCATCGGTGGC
GCCCAAGTTTACGACGCTGCGTTGCGCTCTTCGTCGGCGCGCCGGGTGCTGCTCACCCTCGTCGAGCGCGACTTC
GAATGCGATACCTTCTTCCCCATCACGCTGCCTGGTGCCACTGGCTGGGCCCGCAGGTCCTCTGACGAGCTGCGA
CGCTGGACCGGCGAGGACGCCGATTCTGTCCATCACGAGGAGAACGGCATCAAGTACGAATTCCAGATGTGGGAG
GTCTCCCAATGA
Transcript >Ophcf2|04483
ATGCAACCTCCCGAGCTGACACTCATCGTCGCAGCAACCCGCTCCATGGGAATCGGTGCCCAAGGTTCCCTCCCC
TGGACCGGCCTGCGCAGGGAGCTACAATACTTTGCCCGCGTAACCACCCGGTCACCGCCACAGGCACCCCCCGGA
GCCATCAACGGCGTCATAATGGGCCGAAACACATGGGATTCCATCCCGCCCAAGTTCCGCCCGCTCAAGAACCGT
CTCAACATCGTCCTCACCCGTTCCGCCCCTTCGCTGGACGACGGCGATGTCCCGACGCCCGATCCGCTTCAGCCC
CTGCGCGTGCCCTCGTTCGACGATGCCCTCCGCTACGCAGCCCGTCACTGCCCCCGCGTCTTCGTCATCGGTGGC
GCCCAAGTTTACGACGCTGCGTTGCGCTCTTCGTCGGCGCGCCGGGTGCTGCTCACCCTCGTCGAGCGCGACTTC
GAATGCGATACCTTCTTCCCCATCACGCTGCCTGGTGCCACTGGCTGGGCCCGCAGGTCCTCTGACGAGCTGCGA
CGCTGGACCGGCGAGGACGCCGATTCTGTCCATCACGAGGAGAACGGCATCAAGTACGAATTCCAGATGTGGGAG
GTCTCCCAATGA
Gene >Ophcf2|04483
ATGCAACCTCCCGAGCTGACACTCATCGTCGCAGCAACCCGCTCCATGGGAATCGGTGCCCAAGGTTCCCTCCCC
TGGACCGGCCTGCGCAGGGAGCTACAATACTTTGCCCGCGTAACCACCCGGTCACCGCCACAGGTCGGACTCCGA
AAGCCCTGCCCCCGTCCCTTGTCTACGACGAGTCATACTTACCAGATGCGCCAGGCACCCCCCGGAGCCATCAAC
GGCGTCATAATGGGCCGAAACACATGGGATTCCATCCCGCCCAAGTTCCGCCCGCTCAAGAACCGTCTCAACATC
GTCCTCACCCGTTCCGCCCCTTCGCTGGACGACGGCGATGTCCCGACGCCCGATCCGCTTCAGCCCCTGCGCGTG
CCCTCGTTCGACGATGCCCTCCGCTACGCAGCCCGTCACTGCCCCCGCGTCTTCGTCATCGGTGGCGCCCAAGTT
TACGACGCTGCGTTGCGCTCTTCGTCGGCGCGCCGGGTGCTGCTCACCCTCGTCGAGCGCGACTTCGAATGCGAT
ACCTTCTTCCCCATCACGCTGCCTGGTGCCACTGGCTGGGCCCGCAGGTCCTCTGACGAGCTGCGACGCTGGACC
GGCGAGGACGCCGATTCTGTCCATCACGAGGAGAACGGCATCAAGTACGAATTCCAGATGTGGGAGGTCTCCCAA
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail