Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04482
Gene name
Locationscaffold_04:3370952..3372643
Strand+
Gene length (bp)1691
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.2E-20 97 263
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 6.4E-22 336 477

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 71 93 22
2 97 116 19
3 129 151 22
4 161 183 22
5 204 226 22
6 239 261 22
7 331 353 22
8 368 390 22
9 403 425 22
10 435 452 17
11 459 481 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 84.63 48.54 120.73
Alive In ants, during behavior modification 124.45 66.48 182.42
Dead In ants, recently dead 128.18 71.14 185.21

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.040056 yes
Alive Dead 0.894011 no
Dead Fungus 0.020456 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04482
MSSQTEPGAGAGERTALLPHGSSSAEDASARPQGSSAYALFLDQRHTPGRDSQRLPVRSAARFWHVTKVTLLSNY
VNFFLVTVPVGIVAGSMSWNPVAVFTINFLAIIPLAAVLSFATEEIANRLGEAMGGLLSATFGNAVELIVSIVAL
RDGQIEVVQSSMLGSILSNLLLVMGTCFLLGGIRNRGTSGDGSQQEFTEAVAQTTCSLMTLASASLVLPAALYTV
MNKTGSGGKNMQDIILVLSHGTAVLLLLLYVAYLIFQLRTHSNLFDAELQKLLKEEEAAARAGQGSNSQAQNGTR
EPQNSTANNVQVQNTSTSPQPEEDVEPQMGPLAALTVLVITTILVAICADYLVKSIDAVVEKENISKTFIGLILI
PIVGNAAEHVTAVVMAVRNKMNLAMGVAIGSSIQIALGLTPFLVIVGWIMGQPMSLHFETFATVAFAISVLVATY
VIQDGKSNYLEGAMLIGLYIIIAVAFYVAPGDALHKVPPPPGGLA*
Coding >Ophcf2|04482
ATGAGCTCACAGACGGAGCCGGGCGCCGGAGCCGGAGAGCGCACGGCCCTTCTCCCCCATGGTTCGTCTTCCGCA
GAGGACGCTTCGGCCCGGCCTCAGGGGTCGTCTGCCTACGCCCTCTTCCTCGATCAGAGACATACTCCCGGGAGA
GATAGCCAGAGACTGCCCGTCAGGTCTGCTGCTCGCTTCTGGCACGTCACCAAGGTGACTCTTCTCAGCAACTAT
GTCAACTTTTTCCTCGTCACCGTGCCCGTCGGCATCGTCGCCGGCTCCATGTCGTGGAACCCCGTCGCCGTCTTC
ACCATCAACTTCCTGGCCATCATCCCGCTTGCCGCCGTCTTGTCCTTCGCCACCGAGGAGATCGCCAACAGGCTC
GGTGAAGCTATGGGCGGGCTCCTCAGTGCCACCTTTGGCAACGCCGTTGAACTCATCGTTAGCATCGTCGCCCTC
AGAGACGGCCAGATCGAAGTCGTCCAGTCCTCGATGCTGGGCTCTATTCTATCCAACCTGCTGCTCGTCATGGGC
ACGTGCTTTCTTCTCGGTGGCATTCGCAACCGGGGTACAAGCGGCGACGGCTCACAGCAAGAGTTTACAGAGGCT
GTCGCGCAGACGACGTGCTCTTTGATGACGCTGGCATCCGCTTCTCTCGTCCTCCCTGCCGCTCTGTATACCGTC
ATGAATAAGACCGGCTCCGGCGGAAAGAACATGCAGGACATTATCCTCGTTCTCTCCCATGGAACAGCCGTTCTA
CTGCTCTTGCTCTATGTCGCGTATCTCATCTTTCAGCTCCGCACACATAGCAATCTCTTTGATGCCGAGCTGCAG
AAACTGTTGAAGGAAGAAGAGGCCGCTGCGCGCGCCGGACAGGGAAGCAATAGCCAGGCTCAGAACGGCACGAGG
GAACCCCAGAACTCCACGGCCAACAACGTCCAGGTCCAGAACACCAGTACCTCTCCTCAGCCCGAGGAAGACGTC
GAACCGCAAATGGGCCCCTTGGCCGCCCTCACCGTCCTCGTCATCACCACCATCCTCGTCGCCATCTGCGCAGAC
TATCTCGTCAAGAGCATAGACGCCGTCGTCGAAAAGGAAAACATAAGCAAGACCTTTATCGGACTCATCCTCATC
CCCATCGTCGGCAACGCAGCCGAGCACGTCACCGCCGTCGTCATGGCGGTCCGAAACAAGATGAATCTAGCCATG
GGCGTCGCCATCGGGTCCTCGATTCAGATTGCGCTTGGCCTCACTCCGTTTTTGGTCATCGTCGGTTGGATCATG
GGTCAGCCCATGAGTCTTCACTTCGAGACGTTTGCGACGGTGGCCTTTGCTATATCCGTCTTGGTTGCTACCTAC
GTTATCCAGGATGGCAAGTCCAACTATCTCGAAGGTGCCATGCTCATCGGGCTGTACATCATCATCGCCGTCGCC
TTTTACGTCGCGCCCGGCGATGCTTTGCACAAGGTTCCGCCGCCGCCGGGAGGTCTGGCGTAG
Transcript >Ophcf2|04482
ATGAGCTCACAGACGGAGCCGGGCGCCGGAGCCGGAGAGCGCACGGCCCTTCTCCCCCATGGTTCGTCTTCCGCA
GAGGACGCTTCGGCCCGGCCTCAGGGGTCGTCTGCCTACGCCCTCTTCCTCGATCAGAGACATACTCCCGGGAGA
GATAGCCAGAGACTGCCCGTCAGGTCTGCTGCTCGCTTCTGGCACGTCACCAAGGTGACTCTTCTCAGCAACTAT
GTCAACTTTTTCCTCGTCACCGTGCCCGTCGGCATCGTCGCCGGCTCCATGTCGTGGAACCCCGTCGCCGTCTTC
ACCATCAACTTCCTGGCCATCATCCCGCTTGCCGCCGTCTTGTCCTTCGCCACCGAGGAGATCGCCAACAGGCTC
GGTGAAGCTATGGGCGGGCTCCTCAGTGCCACCTTTGGCAACGCCGTTGAACTCATCGTTAGCATCGTCGCCCTC
AGAGACGGCCAGATCGAAGTCGTCCAGTCCTCGATGCTGGGCTCTATTCTATCCAACCTGCTGCTCGTCATGGGC
ACGTGCTTTCTTCTCGGTGGCATTCGCAACCGGGGTACAAGCGGCGACGGCTCACAGCAAGAGTTTACAGAGGCT
GTCGCGCAGACGACGTGCTCTTTGATGACGCTGGCATCCGCTTCTCTCGTCCTCCCTGCCGCTCTGTATACCGTC
ATGAATAAGACCGGCTCCGGCGGAAAGAACATGCAGGACATTATCCTCGTTCTCTCCCATGGAACAGCCGTTCTA
CTGCTCTTGCTCTATGTCGCGTATCTCATCTTTCAGCTCCGCACACATAGCAATCTCTTTGATGCCGAGCTGCAG
AAACTGTTGAAGGAAGAAGAGGCCGCTGCGCGCGCCGGACAGGGAAGCAATAGCCAGGCTCAGAACGGCACGAGG
GAACCCCAGAACTCCACGGCCAACAACGTCCAGGTCCAGAACACCAGTACCTCTCCTCAGCCCGAGGAAGACGTC
GAACCGCAAATGGGCCCCTTGGCCGCCCTCACCGTCCTCGTCATCACCACCATCCTCGTCGCCATCTGCGCAGAC
TATCTCGTCAAGAGCATAGACGCCGTCGTCGAAAAGGAAAACATAAGCAAGACCTTTATCGGACTCATCCTCATC
CCCATCGTCGGCAACGCAGCCGAGCACGTCACCGCCGTCGTCATGGCGGTCCGAAACAAGATGAATCTAGCCATG
GGCGTCGCCATCGGGTCCTCGATTCAGATTGCGCTTGGCCTCACTCCGTTTTTGGTCATCGTCGGTTGGATCATG
GGTCAGCCCATGAGTCTTCACTTCGAGACGTTTGCGACGGTGGCCTTTGCTATATCCGTCTTGGTTGCTACCTAC
GTTATCCAGGATGGCAAGTCCAACTATCTCGAAGGTGCCATGCTCATCGGGCTGTACATCATCATCGCCGTCGCC
TTTTACGTCGCGCCCGGCGATGCTTTGCACAAGGTTCCGCCGCCGCCGGGAGGTCTGGCGTAG
Gene >Ophcf2|04482
ATGAGCTCACAGACGGAGCCGGGCGCCGGAGCCGGAGAGCGCACGGCCCTTCTCCCCCATGGTTCGTCTTCCGCA
GAGGACGCTTCGGCCCGGCCTCAGGGGTCGTCTGCCTACGCCCTCTTCCTCGATCAGAGACATACTCCCGGGAGA
GATAGCCAGAGACTGCCCGTCAGGTCTGCTGCTCGCTTCTGGCACGTCACCAAGGTGACTCTTCTCAGCAGTCAG
TCTACTATACCTGATCAGCTTTCTGTCCTCCAAGTCTGACCGTCGATAGACTATGTCAACTTTTTCCTCGTCACC
GTGCCCGTCGGCATCGTCGCCGGCTCCATGTCGTGGAACCCCGTCGCCGTCTTCACCATCAACTTCCTGGCCATC
ATCCCGCTTGCCGCCGTCTTGTCCTTCGCCACCGAGGAGATCGCCAACAGGCTCGGTGAAGCTATGGGCGGGCTC
CTCAGTGCCACCTTTGGCAACGCCGTTGAACTCATCGTGCGTACTCGATTTCTTCGACTCGACTCAGAAACTCAT
CTGTCCTAGGTTAGCATCGTCGCCCTCAGAGACGGCCAGATCGAAGTCGTCCAGTCCTCGATGCTGGGCTCTATT
CTATCCAACCTGCTGCTCGTCATGGGCACGTGCTTTCTTCTCGGTGGCATTCGCAACCGGGGTACAAGCGGCGAC
GGCTCACAGCAAGAGTTTACAGAGGCTGTCGCGCAGACGACGTGCTCTTTGATGACGCTGGCATCCGCTTCTCTC
GTCCTCCCTGCCGCTGTAGGATGCCCCGATTCCTTGGACGATCCCGTCTTACTGATCTCGGCCGACGCAGCTGTA
TACCGTCATGAATAAGACCGGCTCCGGCGGAAAGAACATGCAGGACATTATCCTCGTTCTCTCCCATGGAACAGC
CGTTCTACTGCTCTTGCTCTATGTCGCGTATCTCATCTTTCAGCTCCGCACACATAGCAATCTCTTTGATGCCGA
GCTGCAGAAACTGTTGAAGGAAGAAGAGGCCGCTGCGCGCGCCGGACAGGGAAGCAATAGCCAGGCTCAGAACGG
CACGAGGGAACCCCAGAACTCCACGGCCAACAACGTCCAGGTCCAGAACACCAGTACCTCTCCTCAGCCCGAGGA
AGACGTCGAACCGCAAATGGGCCCCTTGGCCGCCCTCACCGTCCTCGTCATCACCACCATCCTCGTCGCCATCTG
CGCAGACTATCTCGTCAAGAGCATAGACGCCGTCGTCGAAAAGGAAAACATAAGCAAGACCTTTATCGGACTCAT
CCTCATCCCCATCGTCGGCAACGCAGCCGAGCACGTCACCGCCGTCGTCATGGCGGTCCGAAACAAGATGAATCT
AGCCATGGGCGTCGCCATCGGGTCCTCGATTCAGATTGCGCTTGGCCTCACTCCGTTTTTGGTCATCGTCGGTTG
GATCATGGGTCAGCCCATGAGTCTTCACTTCGAGACGTGTAAGTCCCGCGTCACCAATCATCATGGCAGGGCTGA
CAGGAACAGTTGCGACGGTGGCCTTTGCTATATCCGTCTTGGTTGCTACCTACGTTATCCAGGATGGCAAGTCCA
ACTATCTCGAAGGTGCCATGCTCATCGGGCTGTACATCATCATCGCCGTCGCCTTTTACGTCGCGCCCGGCGATG
CTTTGCACAAGGTTCCGCCGCCGCCGGGAGGTCTGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail