Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04479
Gene name
Locationscaffold_04:3361223..3366218
Strand+
Gene length (bp)4995
Transcript length (bp)4875
Coding sequence length (bp)4875
Protein length (aa) 1625

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00004 AAA ATPase family associated with various cellular activities (AAA) 1.2E-42 631 766
PF17862 AAA_lid_3 AAA+ lid domain 3.5E-08 791 824

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04479
MVNKRKRALEEFDPNKSDSGDENFDPSSTRPARSSKKARSSRTSRTGRKKTNRYRGSDIEDDENEDVSESQADSY
VDGPESEYDENAPVNAAGRRTRKAAINRTNYKESSEDDDDDRSTHTTGTERGTKRKRAAVPAADEEAAPSPGKSK
VRRLVKLKVPKAAKMPPTTRRSTRASTAESEELVELSTSGRHAVASRSKSPEAYTRLRRSSRALKGLKSAPEPIE
PIQEATQESSALPVDDDAADELSPDNKPTEAEEQGPQETPKAVEEAQEEKEAVEEEAAGDDGQVREEEDYGEDND
ADDDDDDDVPLTRRTRSARPTATVAEEGESDSVPKETVTRRLTRGSRPKKATQEPSSDFEPGDDSDDGDMSEKGK
TQDDDDEDSTTPRPRRSGRNSRRGRNSGDEEPEFDMAELNEEARELRQSSRPRRRPRQPSPIVYQESTRRSRAKV
NYYMPPLTAVNIDEEEAEDPAPTPLRPRRGKAAGGGGWERNLNTTFGPFGGGGGGGSILGGPWGTGAAGGADSDS
SDDEMVHRSSVAANVGMTPTSAAPGAFLLGGQGFNAEAAGATPNVGRIKDRKALADADPLGVDMNVDFTKVGGLQ
GHIDQLKEMVQLPLLYPELFTKFHVTPPRGVLFHGPPGTGKTLLARALANSVGSGGRKISFYMRKGADALSKWVG
EAEKQLRLLFEEARKNQPSIIFFDEIDGLAPVRSSKQEQIHASIVSTLLALMDGMDGRGQVIVIGATNRPDNIDP
ALRRPGRFDREFYFPLPDMDGRRSILDIHTKDWGLSEPFLTSLAEKTKGYGGADLRALCTEAALNSIQRTYPQIY
SSRQKLIVDPDKIAIHASDFMMCIKKLIPSSERSATSGAQPLPNGVEPLLRAQFGDARDALNGLLPRKKKLTALE
EAMFEPFDDEDHGFGREMIYQEFERSRVFRPRLLIYGMAGMGQGYISSALLHHLEGVHVQNFDLPSLLADGRPME
QVIVSLFTEVRRHKPSVIYIPNIDTWFAALAGTVAFATFQTMLKTVPPTDPILVLATADCGQRAPPAELSRELFG
FSRKNRMEIVRPERPNRMEYFQRTLSYVKKKPADFPDPENRKKRMLEELPTAPTIQPRAPSRMERKAVQKKDHQL
LNGLKIQLQPIMDQINRRYKKFRQPVIPQSQIEYLFAESDPNFVRPDINSGEVRPFEVVKDKRGNDVLRDTASGK
CFYNLETTTIEERLSNGFYARPKDFLFDIKALARDAKNIGDKERTLKANELLSNVEVDVAGIETSTAHLDWEGLY
QRQIQRAKEAADKERKRKAMQSITDKFQSEHSDSQGPLTLGETVPGSRTTARFRLRSPPANGQSQAQVQSRSGPS
NGASTSPEEVGKDGDVRMSGVGDEGASSAAQPSSVMGPPPRSDGDASASKQISQRSAMTSLPAGVSPSAVVNEEA
STKTSDNSTLQRSSNSSTQLTNGNHGERRGKGRHEDSESELPNTLPMSNQGTSPNQGVTSSDEPWPHSQAQAQAK
SREAATAETPAAGAAVPSQGDQQHQGSAQAQGQQPGQGRHSSQPMSIEMAVDKFLIDVTDGTSGCTIEQLEQINR
ELMDEIWQRRHEWNRLKVLNQVIGVFNDTISEMEGVESMWSQSREDEAE*
Coding >Ophcf2|04479
ATGGTGAACAAACGGAAGAGAGCTCTCGAGGAGTTCGACCCAAACAAGTCGGATTCGGGCGATGAAAATTTCGAC
CCCAGCAGCACGCGTCCTGCACGAAGCTCAAAGAAGGCTCGGTCTTCGCGTACATCTCGCACTGGCCGCAAGAAG
ACCAATCGCTATCGCGGCTCTGATATCGAGGACGACGAAAATGAAGATGTTTCCGAAAGCCAGGCCGATTCCTAC
GTCGATGGCCCCGAATCCGAGTACGACGAGAACGCTCCCGTCAACGCCGCTGGTCGACGAACTCGCAAGGCTGCC
ATCAATCGTACAAACTACAAGGAGAGCAGCGAGGATGATGACGATGACCGAAGCACCCATACCACTGGAACCGAA
AGGGGAACCAAGAGGAAGCGGGCTGCAGTGCCCGCAGCCGACGAAGAGGCCGCTCCCTCGCCGGGCAAGTCCAAG
GTGCGGCGCCTTGTCAAGCTCAAGGTCCCCAAGGCGGCCAAGATGCCGCCGACAACCCGCAGGTCGACGCGTGCG
AGCACCGCAGAAAGCGAGGAACTTGTCGAGCTGTCCACCTCGGGCCGCCATGCCGTCGCCTCTCGGAGCAAGAGC
CCCGAAGCGTACACCCGCCTCCGTCGATCCTCCCGCGCACTGAAGGGTCTGAAGTCTGCCCCTGAACCGATAGAA
CCGATTCAGGAGGCGACTCAGGAGAGCAGTGCCTTGCCGGTGGACGACGATGCAGCCGATGAGCTCTCGCCCGAC
AATAAGCCGACCGAGGCTGAAGAGCAGGGTCCGCAGGAGACCCCCAAAGCTGTTGAGGAAGCCCAAGAGGAGAAA
GAAGCTGTTGAGGAAGAAGCTGCCGGAGATGATGGGCAAGTTAGAGAAGAGGAAGATTATGGTGAAGACAATGAC
GCTGACGATGACGATGACGATGACGTTCCTCTTACGAGAAGAACTAGATCAGCAAGACCTACCGCTACGGTGGCT
GAGGAAGGAGAATCCGACAGCGTCCCCAAGGAGACGGTGACCCGTCGTCTCACGCGCGGCTCTCGTCCCAAGAAG
GCGACGCAAGAGCCCAGCAGCGATTTCGAGCCCGGCGATGACTCGGATGATGGCGACATGTCCGAGAAGGGCAAG
ACGCAGGATGACGACGACGAGGATAGTACGACTCCGCGACCCAGACGCAGCGGGCGCAATTCGCGTCGCGGACGC
AACTCGGGCGATGAGGAGCCCGAGTTTGACATGGCCGAGCTCAACGAGGAAGCTCGAGAGTTGCGCCAGTCGTCT
CGGCCTCGACGCCGCCCTCGACAACCGTCGCCCATCGTGTACCAGGAGAGCACGAGGCGTTCGCGAGCCAAGGTC
AACTACTACATGCCGCCCTTGACGGCGGTCAACATTGACGAGGAGGAGGCCGAGGACCCGGCTCCGACGCCGCTA
CGACCCCGTCGAGGCAAGGCTGCTGGTGGCGGCGGTTGGGAACGCAACCTGAACACCACCTTCGGACCCTTTGGC
GGCGGAGGCGGAGGCGGCTCCATCCTCGGAGGGCCCTGGGGAACCGGGGCAGCCGGCGGTGCCGACTCGGACAGC
AGTGATGATGAGATGGTTCATCGCTCCAGCGTCGCCGCTAACGTCGGCATGACGCCCACCTCTGCTGCTCCGGGA
GCTTTCTTGCTCGGCGGTCAAGGCTTCAATGCCGAGGCCGCCGGTGCGACGCCCAACGTCGGCAGGATCAAGGAC
CGCAAGGCTCTAGCTGATGCGGATCCCCTCGGCGTCGACATGAACGTCGACTTCACCAAGGTCGGAGGCCTGCAG
GGCCACATCGACCAGCTCAAGGAGATGGTGCAGCTACCTCTCCTATATCCGGAGCTCTTCACCAAGTTCCACGTC
ACGCCGCCCCGTGGCGTGCTGTTCCATGGTCCCCCCGGTACCGGAAAGACGCTGCTGGCTCGTGCCCTCGCGAAC
TCGGTCGGCTCCGGCGGCCGCAAGATCTCCTTTTACATGCGCAAGGGCGCCGATGCCCTCAGCAAATGGGTGGGT
GAGGCCGAAAAGCAGCTGCGGCTTCTCTTCGAGGAGGCTCGCAAGAATCAGCCGAGCATCATCTTCTTTGACGAG
ATTGATGGCTTGGCTCCCGTTCGATCCAGCAAGCAGGAGCAGATCCATGCTTCGATCGTCTCGACGCTTTTGGCC
CTCATGGACGGCATGGACGGCCGCGGCCAGGTCATCGTCATAGGAGCCACCAACCGGCCGGATAACATCGATCCC
GCCCTTCGCCGTCCGGGGCGCTTCGACCGAGAGTTTTACTTTCCCCTACCAGACATGGACGGCCGGCGCTCCATC
CTCGACATCCACACCAAGGATTGGGGCCTGTCGGAGCCCTTCTTGACCTCGCTGGCCGAGAAGACCAAGGGCTAC
GGCGGCGCCGACCTGCGGGCGCTATGCACCGAGGCGGCGCTCAACTCCATCCAGCGCACCTATCCCCAGATTTAT
TCGTCCCGGCAGAAGCTCATTGTCGACCCCGACAAGATTGCCATCCACGCCTCCGACTTCATGATGTGTATCAAA
AAGTTGATACCGTCGTCGGAGCGGTCCGCGACTTCGGGGGCCCAGCCGCTGCCCAACGGCGTCGAGCCCCTGCTT
CGGGCTCAGTTTGGAGACGCGAGAGACGCCTTGAACGGCTTGCTTCCGCGAAAGAAGAAGCTCACGGCGCTTGAG
GAGGCCATGTTTGAGCCCTTTGACGATGAAGATCACGGGTTCGGTCGCGAGATGATTTATCAGGAGTTTGAGCGG
TCTCGCGTCTTCCGCCCCCGACTCCTCATCTACGGAATGGCCGGCATGGGTCAGGGCTACATCTCTTCGGCTCTT
TTGCATCATCTCGAGGGAGTTCATGTGCAGAACTTTGACCTCCCCAGCTTGCTGGCCGATGGACGACCTATGGAA
CAGGTCATTGTCAGCCTCTTTACCGAGGTCAGACGGCACAAGCCCAGTGTCATCTACATCCCCAATATCGACACC
TGGTTCGCCGCGTTAGCCGGCACGGTAGCGTTTGCCACGTTCCAGACGATGTTGAAGACGGTCCCGCCCACGGAT
CCCATCTTGGTGCTCGCCACGGCCGACTGTGGACAGCGAGCGCCTCCCGCTGAGCTGTCTCGTGAGCTGTTTGGC
TTCTCCCGCAAGAACCGAATGGAGATTGTTCGGCCAGAGAGGCCGAACCGCATGGAGTACTTTCAGAGGACGCTC
TCGTACGTGAAGAAGAAGCCGGCCGACTTCCCTGACCCGGAGAACCGGAAGAAGCGAATGCTCGAGGAGCTCCCC
ACCGCTCCCACCATCCAGCCCAGAGCGCCGAGCAGAATGGAGAGGAAGGCGGTTCAGAAGAAGGACCATCAGCTG
CTCAATGGACTCAAGATCCAGCTGCAGCCCATCATGGATCAGATCAACAGGCGGTACAAGAAGTTCAGGCAGCCG
GTGATACCGCAGAGCCAGATCGAGTACCTCTTCGCCGAGAGCGATCCCAACTTTGTTCGTCCCGACATCAACTCG
GGCGAAGTCCGGCCCTTTGAAGTGGTCAAGGACAAGCGCGGAAACGACGTGCTACGGGATACTGCCTCCGGCAAG
TGCTTTTACAACCTGGAGACGACGACCATCGAGGAGCGGCTGTCCAACGGCTTCTACGCGCGTCCCAAAGACTTC
TTGTTCGACATCAAGGCGCTCGCGAGGGACGCCAAGAATATCGGCGACAAGGAGCGAACGCTCAAGGCCAACGAG
CTCTTGAGCAACGTCGAGGTAGACGTGGCTGGCATCGAGACCAGCACTGCCCATCTCGACTGGGAGGGTCTGTAT
CAGCGTCAGATCCAGCGCGCCAAGGAGGCGGCCGATAAGGAGCGGAAGCGCAAGGCGATGCAGTCCATTACGGAC
AAGTTCCAGTCGGAACACAGCGACTCGCAAGGACCTCTCACGCTGGGCGAGACGGTTCCCGGATCGCGGACCACG
GCCCGGTTCCGCCTCCGAAGCCCGCCTGCGAACGGACAGAGCCAGGCGCAGGTGCAGTCGCGAAGCGGCCCGAGC
AACGGGGCGTCTACCTCGCCAGAGGAGGTCGGAAAGGATGGCGACGTGCGGATGAGCGGCGTCGGCGATGAGGGG
GCATCGTCGGCAGCTCAGCCGTCGTCGGTCATGGGGCCGCCTCCCAGGTCGGACGGGGACGCGTCGGCATCGAAG
CAAATCTCGCAGAGGTCGGCCATGACGTCGCTGCCGGCCGGAGTCTCGCCCTCGGCCGTCGTCAACGAGGAGGCG
TCGACCAAGACGTCGGACAATTCGACGCTGCAGCGGTCGTCCAACTCGAGCACGCAGTTGACCAACGGGAACCAT
GGAGAGCGAAGAGGCAAGGGGAGACACGAGGATAGCGAATCGGAGCTGCCCAACACGCTGCCCATGTCGAACCAG
GGGACGTCGCCCAACCAGGGTGTGACGTCGAGCGACGAGCCGTGGCCTCACTCGCAGGCCCAGGCCCAAGCCAAG
AGCCGAGAGGCGGCGACGGCGGAGACTCCCGCGGCGGGTGCGGCGGTGCCCTCGCAGGGGGATCAGCAGCATCAG
GGGTCGGCGCAGGCTCAGGGACAGCAGCCTGGCCAGGGGCGTCACTCTTCGCAGCCCATGTCGATCGAGATGGCC
GTCGACAAGTTCCTGATTGACGTGACGGACGGCACGTCGGGCTGCACGATCGAGCAGTTGGAGCAGATCAACCGA
GAGCTCATGGACGAAATCTGGCAACGAAGACACGAATGGAACAGGCTTAAGGTGCTGAACCAGGTCATCGGTGTC
TTTAACGACACGATTAGCGAGATGGAGGGTGTCGAGAGCATGTGGTCACAGAGTCGAGAGGATGAGGCCGAGTGA
Transcript >Ophcf2|04479
ATGGTGAACAAACGGAAGAGAGCTCTCGAGGAGTTCGACCCAAACAAGTCGGATTCGGGCGATGAAAATTTCGAC
CCCAGCAGCACGCGTCCTGCACGAAGCTCAAAGAAGGCTCGGTCTTCGCGTACATCTCGCACTGGCCGCAAGAAG
ACCAATCGCTATCGCGGCTCTGATATCGAGGACGACGAAAATGAAGATGTTTCCGAAAGCCAGGCCGATTCCTAC
GTCGATGGCCCCGAATCCGAGTACGACGAGAACGCTCCCGTCAACGCCGCTGGTCGACGAACTCGCAAGGCTGCC
ATCAATCGTACAAACTACAAGGAGAGCAGCGAGGATGATGACGATGACCGAAGCACCCATACCACTGGAACCGAA
AGGGGAACCAAGAGGAAGCGGGCTGCAGTGCCCGCAGCCGACGAAGAGGCCGCTCCCTCGCCGGGCAAGTCCAAG
GTGCGGCGCCTTGTCAAGCTCAAGGTCCCCAAGGCGGCCAAGATGCCGCCGACAACCCGCAGGTCGACGCGTGCG
AGCACCGCAGAAAGCGAGGAACTTGTCGAGCTGTCCACCTCGGGCCGCCATGCCGTCGCCTCTCGGAGCAAGAGC
CCCGAAGCGTACACCCGCCTCCGTCGATCCTCCCGCGCACTGAAGGGTCTGAAGTCTGCCCCTGAACCGATAGAA
CCGATTCAGGAGGCGACTCAGGAGAGCAGTGCCTTGCCGGTGGACGACGATGCAGCCGATGAGCTCTCGCCCGAC
AATAAGCCGACCGAGGCTGAAGAGCAGGGTCCGCAGGAGACCCCCAAAGCTGTTGAGGAAGCCCAAGAGGAGAAA
GAAGCTGTTGAGGAAGAAGCTGCCGGAGATGATGGGCAAGTTAGAGAAGAGGAAGATTATGGTGAAGACAATGAC
GCTGACGATGACGATGACGATGACGTTCCTCTTACGAGAAGAACTAGATCAGCAAGACCTACCGCTACGGTGGCT
GAGGAAGGAGAATCCGACAGCGTCCCCAAGGAGACGGTGACCCGTCGTCTCACGCGCGGCTCTCGTCCCAAGAAG
GCGACGCAAGAGCCCAGCAGCGATTTCGAGCCCGGCGATGACTCGGATGATGGCGACATGTCCGAGAAGGGCAAG
ACGCAGGATGACGACGACGAGGATAGTACGACTCCGCGACCCAGACGCAGCGGGCGCAATTCGCGTCGCGGACGC
AACTCGGGCGATGAGGAGCCCGAGTTTGACATGGCCGAGCTCAACGAGGAAGCTCGAGAGTTGCGCCAGTCGTCT
CGGCCTCGACGCCGCCCTCGACAACCGTCGCCCATCGTGTACCAGGAGAGCACGAGGCGTTCGCGAGCCAAGGTC
AACTACTACATGCCGCCCTTGACGGCGGTCAACATTGACGAGGAGGAGGCCGAGGACCCGGCTCCGACGCCGCTA
CGACCCCGTCGAGGCAAGGCTGCTGGTGGCGGCGGTTGGGAACGCAACCTGAACACCACCTTCGGACCCTTTGGC
GGCGGAGGCGGAGGCGGCTCCATCCTCGGAGGGCCCTGGGGAACCGGGGCAGCCGGCGGTGCCGACTCGGACAGC
AGTGATGATGAGATGGTTCATCGCTCCAGCGTCGCCGCTAACGTCGGCATGACGCCCACCTCTGCTGCTCCGGGA
GCTTTCTTGCTCGGCGGTCAAGGCTTCAATGCCGAGGCCGCCGGTGCGACGCCCAACGTCGGCAGGATCAAGGAC
CGCAAGGCTCTAGCTGATGCGGATCCCCTCGGCGTCGACATGAACGTCGACTTCACCAAGGTCGGAGGCCTGCAG
GGCCACATCGACCAGCTCAAGGAGATGGTGCAGCTACCTCTCCTATATCCGGAGCTCTTCACCAAGTTCCACGTC
ACGCCGCCCCGTGGCGTGCTGTTCCATGGTCCCCCCGGTACCGGAAAGACGCTGCTGGCTCGTGCCCTCGCGAAC
TCGGTCGGCTCCGGCGGCCGCAAGATCTCCTTTTACATGCGCAAGGGCGCCGATGCCCTCAGCAAATGGGTGGGT
GAGGCCGAAAAGCAGCTGCGGCTTCTCTTCGAGGAGGCTCGCAAGAATCAGCCGAGCATCATCTTCTTTGACGAG
ATTGATGGCTTGGCTCCCGTTCGATCCAGCAAGCAGGAGCAGATCCATGCTTCGATCGTCTCGACGCTTTTGGCC
CTCATGGACGGCATGGACGGCCGCGGCCAGGTCATCGTCATAGGAGCCACCAACCGGCCGGATAACATCGATCCC
GCCCTTCGCCGTCCGGGGCGCTTCGACCGAGAGTTTTACTTTCCCCTACCAGACATGGACGGCCGGCGCTCCATC
CTCGACATCCACACCAAGGATTGGGGCCTGTCGGAGCCCTTCTTGACCTCGCTGGCCGAGAAGACCAAGGGCTAC
GGCGGCGCCGACCTGCGGGCGCTATGCACCGAGGCGGCGCTCAACTCCATCCAGCGCACCTATCCCCAGATTTAT
TCGTCCCGGCAGAAGCTCATTGTCGACCCCGACAAGATTGCCATCCACGCCTCCGACTTCATGATGTGTATCAAA
AAGTTGATACCGTCGTCGGAGCGGTCCGCGACTTCGGGGGCCCAGCCGCTGCCCAACGGCGTCGAGCCCCTGCTT
CGGGCTCAGTTTGGAGACGCGAGAGACGCCTTGAACGGCTTGCTTCCGCGAAAGAAGAAGCTCACGGCGCTTGAG
GAGGCCATGTTTGAGCCCTTTGACGATGAAGATCACGGGTTCGGTCGCGAGATGATTTATCAGGAGTTTGAGCGG
TCTCGCGTCTTCCGCCCCCGACTCCTCATCTACGGAATGGCCGGCATGGGTCAGGGCTACATCTCTTCGGCTCTT
TTGCATCATCTCGAGGGAGTTCATGTGCAGAACTTTGACCTCCCCAGCTTGCTGGCCGATGGACGACCTATGGAA
CAGGTCATTGTCAGCCTCTTTACCGAGGTCAGACGGCACAAGCCCAGTGTCATCTACATCCCCAATATCGACACC
TGGTTCGCCGCGTTAGCCGGCACGGTAGCGTTTGCCACGTTCCAGACGATGTTGAAGACGGTCCCGCCCACGGAT
CCCATCTTGGTGCTCGCCACGGCCGACTGTGGACAGCGAGCGCCTCCCGCTGAGCTGTCTCGTGAGCTGTTTGGC
TTCTCCCGCAAGAACCGAATGGAGATTGTTCGGCCAGAGAGGCCGAACCGCATGGAGTACTTTCAGAGGACGCTC
TCGTACGTGAAGAAGAAGCCGGCCGACTTCCCTGACCCGGAGAACCGGAAGAAGCGAATGCTCGAGGAGCTCCCC
ACCGCTCCCACCATCCAGCCCAGAGCGCCGAGCAGAATGGAGAGGAAGGCGGTTCAGAAGAAGGACCATCAGCTG
CTCAATGGACTCAAGATCCAGCTGCAGCCCATCATGGATCAGATCAACAGGCGGTACAAGAAGTTCAGGCAGCCG
GTGATACCGCAGAGCCAGATCGAGTACCTCTTCGCCGAGAGCGATCCCAACTTTGTTCGTCCCGACATCAACTCG
GGCGAAGTCCGGCCCTTTGAAGTGGTCAAGGACAAGCGCGGAAACGACGTGCTACGGGATACTGCCTCCGGCAAG
TGCTTTTACAACCTGGAGACGACGACCATCGAGGAGCGGCTGTCCAACGGCTTCTACGCGCGTCCCAAAGACTTC
TTGTTCGACATCAAGGCGCTCGCGAGGGACGCCAAGAATATCGGCGACAAGGAGCGAACGCTCAAGGCCAACGAG
CTCTTGAGCAACGTCGAGGTAGACGTGGCTGGCATCGAGACCAGCACTGCCCATCTCGACTGGGAGGGTCTGTAT
CAGCGTCAGATCCAGCGCGCCAAGGAGGCGGCCGATAAGGAGCGGAAGCGCAAGGCGATGCAGTCCATTACGGAC
AAGTTCCAGTCGGAACACAGCGACTCGCAAGGACCTCTCACGCTGGGCGAGACGGTTCCCGGATCGCGGACCACG
GCCCGGTTCCGCCTCCGAAGCCCGCCTGCGAACGGACAGAGCCAGGCGCAGGTGCAGTCGCGAAGCGGCCCGAGC
AACGGGGCGTCTACCTCGCCAGAGGAGGTCGGAAAGGATGGCGACGTGCGGATGAGCGGCGTCGGCGATGAGGGG
GCATCGTCGGCAGCTCAGCCGTCGTCGGTCATGGGGCCGCCTCCCAGGTCGGACGGGGACGCGTCGGCATCGAAG
CAAATCTCGCAGAGGTCGGCCATGACGTCGCTGCCGGCCGGAGTCTCGCCCTCGGCCGTCGTCAACGAGGAGGCG
TCGACCAAGACGTCGGACAATTCGACGCTGCAGCGGTCGTCCAACTCGAGCACGCAGTTGACCAACGGGAACCAT
GGAGAGCGAAGAGGCAAGGGGAGACACGAGGATAGCGAATCGGAGCTGCCCAACACGCTGCCCATGTCGAACCAG
GGGACGTCGCCCAACCAGGGTGTGACGTCGAGCGACGAGCCGTGGCCTCACTCGCAGGCCCAGGCCCAAGCCAAG
AGCCGAGAGGCGGCGACGGCGGAGACTCCCGCGGCGGGTGCGGCGGTGCCCTCGCAGGGGGATCAGCAGCATCAG
GGGTCGGCGCAGGCTCAGGGACAGCAGCCTGGCCAGGGGCGTCACTCTTCGCAGCCCATGTCGATCGAGATGGCC
GTCGACAAGTTCCTGATTGACGTGACGGACGGCACGTCGGGCTGCACGATCGAGCAGTTGGAGCAGATCAACCGA
GAGCTCATGGACGAAATCTGGCAACGAAGACACGAATGGAACAGGCTTAAGGTGCTGAACCAGGTCATCGGTGTC
TTTAACGACACGATTAGCGAGATGGAGGGTGTCGAGAGCATGTGGTCACAGAGTCGAGAGGATGAGGCCGAGTGA
Gene >Ophcf2|04479
ATGGTGAACAAACGGAAGAGAGCTCTCGAGGAGTTCGACCCAAACAAGTCGGATTCGGGCGATGAAAATTTCGAC
CCCAGCAGCACGCGTCCTGCACGAAGCTCAAAGAAGGCTCGGTCTTCGCGTACATCTCGCACTGGCCGCAAGAAG
ACCAATCGCTATCGCGGCTCTGATATCGAGGACGACGAAAATGAAGATGTTTCCGAAAGCCAGGCCGATTCCTAC
GTCGATGGCCCCGAATCCGAGTACGACGAGAACGCTCCCGTCAACGCCGCTGGTCGACGAACTCGCAAGGCTGCC
ATCAATCGTACAAACTACAAGGAGAGCAGCGAGGATGATGACGATGACCGAAGCACCCATACCACTGGAACCGAA
AGGGGAACCAAGAGGAAGCGGGCTGCAGTGCCCGCAGCCGACGAAGAGGCCGCTCCCTCGCCGGGCAAGTCCAAG
GTGCGGCGCCTTGTCAAGCTCAAGGTCCCCAAGGCGGCCAAGATGCCGCCGACAACCCGCAGGTCGACGCGTGCG
AGCACCGCAGAAAGCGAGGAACTTGTCGAGCTGTCCACCTCGGGCCGCCATGCCGTCGCCTCTCGGAGCAAGAGC
CCCGAAGCGTACACCCGCCTCCGTCGATCCTCCCGCGCACTGAAGGGTCTGAAGTCTGCCCCTGAACCGATAGAA
CCGATTCAGGAGGCGACTCAGGAGAGCAGTGCCTTGCCGGTGGACGACGATGCAGCCGATGAGCTCTCGCCCGAC
AATAAGCCGACCGAGGCTGAAGAGCAGGGTCCGCAGGAGACCCCCAAAGCTGTTGAGGAAGCCCAAGAGGAGAAA
GAAGCTGTTGAGGAAGAAGCTGCCGGAGATGATGGGCAAGTTAGAGAAGAGGAAGATTATGGTGAAGACAATGAC
GCTGACGATGACGATGACGATGACGTTCCTCTTACGAGAAGAACTAGATCAGCAAGACCTACCGCTACGGTGGCT
GAGGAAGGAGAATCCGACAGCGTCCCCAAGGAGACGGTGACCCGTCGTCTCACGCGCGGCTCTCGTCCCAAGAAG
GCGACGCAAGAGCCCAGCAGCGATTTCGAGCCCGGCGATGACTCGGATGATGGCGACATGTCCGAGAAGGGCAAG
ACGCAGGATGACGACGACGAGGATAGTACGACTCCGCGACCCAGACGCAGCGGGCGCAATTCGCGTCGCGGACGC
AACTCGGGCGATGAGGAGCCCGAGTTTGACATGGCCGAGCTCAACGAGGAAGCTCGAGAGTTGCGCCAGTCGTCT
CGGCCTCGACGCCGCCCTCGACAACCGTCGCCCATCGTGTACCAGGAGAGCACGAGGCGTTCGCGAGCCAAGGTC
AACTACTACATGCCGCCCTTGACGGCGGTCAACATTGACGAGGAGGAGGCCGAGGACCCGGCTCCGACGCCGCTA
CGACCCCGTCGAGGCAAGGCTGCTGGTGGCGGCGGTTGGGAACGCAACCTGAACACCACCTTCGGACCCTTTGGC
GGCGGAGGCGGAGGCGGCTCCATCCTCGGAGGGCCCTGGGGAACCGGGGCAGCCGGCGGTGCCGACTCGGACAGC
AGTGATGATGAGATGGTTCATCGCTCCAGCGTCGCCGCTAACGTCGGCATGACGCCCACCTCTGCTGCTCCGGGA
GCTTTCTTGCTCGGCGGTCAAGGCTTCAATGCCGAGGCCGCCGGTGCGACGCCCAACGTCGGCAGGATCAAGGAC
CGCAAGGCTCTAGCTGATGCGGATCCCCTCGGCGTCGACATGAACGTCGACTTCACCAAGGTCGGAGGCCTGCAG
GGCCACATCGACCAGCTCAAGGAGATGGTGCAGCTACCTCTCCTATATCCGGAGCTCTTCACCAAGTTCCACGTC
ACGCCGCCCCGTGGCGTGCTGTTCCATGGTCCCCCCGGTACCGGAAAGACGCTGCTGGCTCGTGCCCTCGCGAAC
TCGGTCGGCTCCGGCGGCCGCAAGATCTCCTTTTACATGCGCAAGGGCGCCGATGCCCTCAGCAAATGGGTGGGT
GAGGCCGAAAAGCAGCTGCGGCTTCTCTTCGAGGAGGCTCGCAAGAATCAGCCGAGCATCATCTTCTTTGACGAG
ATTGATGGCTTGGCTCCCGTTCGATCCAGCAAGCAGGAGCAGATCCATGCTTCGATCGTCTCGACGCTTTTGGCC
CTCATGGACGGCATGGACGGCCGCGGCCAGGTCATCGTCATAGGAGCCACCAACCGGCCGGATAACATCGATCCC
GCCCTTCGCCGTCCGGGGCGCTTCGACCGAGAGTTTTACTTTCCCCTACCAGACATGGACGGCCGGCGCTCCATC
CTCGACATCCACACCAAGGATTGGGGCCTGTCGGAGCCCTTCTTGACCTCGCTGGCCGAGAAGACCAAGGGCTAC
GGCGGCGCCGACCTGCGGGCGCTATGCACCGAGGCGGCGCTCAACTCCATCCAGCGCACCTATCCCCAGATTTAT
TCGTCCCGGCAGAAGCTCATTGTCGACCCCGACAAGATTGCCATCCACGCCTCCGACTTCATGATGTGTATCAAA
AAGTTGATACCGTCGTCGGAGCGGTCCGCGACTTCGGGGGCCCAGCCGCTGCCCAACGGCGTCGAGCCCCTGCTT
CGGGCTCAGTTTGGAGACGCGAGAGACGCCTTGAACGGCTTGCTTCCGCGAAAGAAGAAGCTCACGGCGCTTGAG
GAGGCCATGTTTGAGCCCTTTGACGATGAAGATCACGGGTTCGGTCGCGAGATGATTTATCAGGAGTTTGAGCGG
TCTCGCGTCTTCCGCCCCCGACTCCTCATCTACGGAATGGCCGGCATGGGTCAGGGCTACATCTCTTCGGCTCTT
TTGCATCATCTCGAGGGAGTTCATGTGCAGAACTTTGACCTCCCCAGCTTGCTGGCCGATGGACGAGTAAGTCTC
CAACCCATCATGGCCGATGTTGATAACCGGCTGACACGGGCACAGCCTATGGAACAGGTCATTGTCAGCCTCTTT
ACCGAGGTCAGACGGCACAAGCCCAGTGTCATCTACATCCCCAATATCGACACCTGGTTCGCCGCGTTAGCCGGC
ACGGTAGCGTTTGCCACGTTCCAGACGATGTTGAAGACGGTCCCGCCCACGGATCCCATCTTGGTGCTCGCCACG
GCCGACTGTGGACAGCGAGCGCCTCCCGCTGAGCTGTCTCGTGAGCTGTTTGGCTTCTCCCGCAAGAACCGAATG
GAGATTGTTCGGCCAGAGAGGGTCAGTACTCCCTGTTACACTACCGTCGTGAGGGCCAAAGCTAACGTCACTTGG
TTGATCTTGCAGCCGAACCGCATGGAGTACTTTCAGAGGACGCTCTCGTACGTGAAGAAGAAGCCGGCCGACTTC
CCTGACCCGGAGAACCGGAAGAAGCGAATGCTCGAGGAGCTCCCCACCGCTCCCACCATCCAGCCCAGAGCGCCG
AGCAGAATGGAGAGGAAGGCGGTTCAGAAGAAGGACCATCAGCTGCTCAATGGACTCAAGATCCAGCTGCAGCCC
ATCATGGATCAGATCAACAGGCGGTACAAGAAGTTCAGGCAGCCGGTGATACCGCAGAGCCAGATCGAGTACCTC
TTCGCCGAGAGCGATCCCAACTTTGTTCGTCCCGACATCAACTCGGGCGAAGTCCGGCCCTTTGAAGTGGTCAAG
GACAAGCGCGGAAACGACGTGCTACGGGATACTGCCTCCGGCAAGTGCTTTTACAACCTGGAGACGACGACCATC
GAGGAGCGGCTGTCCAACGGCTTCTACGCGCGTCCCAAAGACTTCTTGTTCGACATCAAGGCGCTCGCGAGGGAC
GCCAAGAATATCGGCGACAAGGAGCGAACGCTCAAGGCCAACGAGCTCTTGAGCAACGTCGAGGTAGACGTGGCT
GGCATCGAGACCAGCACTGCCCATCTCGACTGGGAGGGTCTGTATCAGCGTCAGATCCAGCGCGCCAAGGAGGCG
GCCGATAAGGAGCGGAAGCGCAAGGCGATGCAGTCCATTACGGACAAGTTCCAGTCGGAACACAGCGACTCGCAA
GGACCTCTCACGCTGGGCGAGACGGTTCCCGGATCGCGGACCACGGCCCGGTTCCGCCTCCGAAGCCCGCCTGCG
AACGGACAGAGCCAGGCGCAGGTGCAGTCGCGAAGCGGCCCGAGCAACGGGGCGTCTACCTCGCCAGAGGAGGTC
GGAAAGGATGGCGACGTGCGGATGAGCGGCGTCGGCGATGAGGGGGCATCGTCGGCAGCTCAGCCGTCGTCGGTC
ATGGGGCCGCCTCCCAGGTCGGACGGGGACGCGTCGGCATCGAAGCAAATCTCGCAGAGGTCGGCCATGACGTCG
CTGCCGGCCGGAGTCTCGCCCTCGGCCGTCGTCAACGAGGAGGCGTCGACCAAGACGTCGGACAATTCGACGCTG
CAGCGGTCGTCCAACTCGAGCACGCAGTTGACCAACGGGAACCATGGAGAGCGAAGAGGCAAGGGGAGACACGAG
GATAGCGAATCGGAGCTGCCCAACACGCTGCCCATGTCGAACCAGGGGACGTCGCCCAACCAGGGTGTGACGTCG
AGCGACGAGCCGTGGCCTCACTCGCAGGCCCAGGCCCAAGCCAAGAGCCGAGAGGCGGCGACGGCGGAGACTCCC
GCGGCGGGTGCGGCGGTGCCCTCGCAGGGGGATCAGCAGCATCAGGGGTCGGCGCAGGCTCAGGGACAGCAGCCT
GGCCAGGGGCGTCACTCTTCGCAGCCCATGTCGATCGAGATGGCCGTCGACAAGTTCCTGATTGACGTGACGGAC
GGCACGTCGGGCTGCACGATCGAGCAGTTGGAGCAGATCAACCGAGAGCTCATGGACGAAATCTGGCAACGAAGA
CACGAATGGAACAGGCTTAAGGTGCTGAACCAGGTCATCGGTGTCTTTAACGACACGATTAGCGAGATGGAGGGT
GTCGAGAGCATGTGGTCACAGAGTCGAGAGGATGAGGCCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail