Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04473
Gene name
Locationscaffold_04:3340002..3340452
Strand+
Gene length (bp)450
Transcript length (bp)270
Coding sequence length (bp)270
Protein length (aa) 90

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07297 DPM2 Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2) 4.2E-31 3 76

GO

GO Term Description Terminal node
GO:0030176 integral component of endoplasmic reticulum membrane Yes
GO:0030234 enzyme regulator activity Yes
GO:0019348 dolichol metabolic process Yes
GO:0044281 small molecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0016093 polyprenol metabolic process No
GO:0008152 metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0016021 integral component of membrane No
GO:0031224 intrinsic component of membrane No
GO:0006066 alcohol metabolic process No
GO:0006720 isoprenoid metabolic process No
GO:0031300 intrinsic component of organelle membrane No
GO:0031227 intrinsic component of endoplasmic reticulum membrane No
GO:0071704 organic substance metabolic process No
GO:0098772 molecular function regulator activity No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0031301 integral component of organelle membrane No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:1901615 organic hydroxy compound metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 47 69 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 251.27 114.41 388.13
Alive In ants, during behavior modification 282.39 126.06 438.72
Dead In ants, recently dead 354.54 175.19 533.90

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.678636 no
Alive Dead 0.275972 no
Dead Fungus 0.126296 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04473
MLDKLLGLAMLVAASVVFLYYSVWTLLMPFVDDDHPLQNFFLPRVWAIRIPVIFVLLVSAVVGSFLGTVMIRSNR
KKASKAKAAAKKKA*
Coding >Ophcf2|04473
ATGCTCGACAAACTCCTGGGCCTCGCCATGCTCGTGGCCGCCTCCGTCGTCTTCCTCTACTACTCCGTCTGGACC
CTCCTCATGCCCTTCGTCGACGACGACCACCCCCTTCAAAACTTCTTCCTCCCTCGCGTCTGGGCCATTCGAATC
CCCGTCATCTTCGTCCTCCTCGTCTCCGCCGTCGTCGGCTCCTTTCTCGGCACCGTCATGATTCGGAGCAACCGC
AAGAAGGCCTCCAAAGCCAAGGCCGCCGCCAAGAAGAAGGCGTGA
Transcript >Ophcf2|04473
ATGCTCGACAAACTCCTGGGCCTCGCCATGCTCGTGGCCGCCTCCGTCGTCTTCCTCTACTACTCCGTCTGGACC
CTCCTCATGCCCTTCGTCGACGACGACCACCCCCTTCAAAACTTCTTCCTCCCTCGCGTCTGGGCCATTCGAATC
CCCGTCATCTTCGTCCTCCTCGTCTCCGCCGTCGTCGGCTCCTTTCTCGGCACCGTCATGATTCGGAGCAACCGC
AAGAAGGCCTCCAAAGCCAAGGCCGCCGCCAAGAAGAAGGCGTGA
Gene >Ophcf2|04473
ATGGTAACCATAACCATCGTTTCATCCCCTCGTTCCCACCAATGCTAACGCCTCGCAGCTCGACAAACTCCTGGG
CCTCGCCATGCTCGTGGCCGCCTCCGTCGTCTTCCTCTACTACTCCGTCTGGACCCTCCTCATGGTCCGTAAAAA
CTCCTGTCTATTTCTCCTCAAGTCCATCTATCCTCAATCTCCCCATTCCTCTGGCGAGCTTACCTCGCGCGCCTC
ACTCCAATTCAAACCTTTACAACTCGCTAATAAGCCCAGCCCTTCGTCGACGACGACCACCCCCTTCAAAACTTC
TTCCTCCCTCGCGTCTGGGCCATTCGAATCCCCGTCATCTTCGTCCTCCTCGTCTCCGCCGTCGTCGGCTCCTTT
CTCGGCACCGTCATGATTCGGAGCAACCGCAAGAAGGCCTCCAAAGCCAAGGCCGCCGCCAAGAAGAAGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail